Mouse mFC tag Monoclonal antibody, PBS Only

• 

  WB analysis using 67122-1-Ig (same clone as 67122-1-PBS)

  67122-1-Ig was lysised and subjected to SDS-PAGE followed by western blot with 67122-1-Ig and isotype control antibody 66360-1-Ig at dilution of 1:5000 incubated at room temperature for 1.5 hours. HRP-goat anti-mouse kappa chain secondary antibody was used for detection. . This data was developed using the same antibody clone with 67122-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67122-1-Ig (same clone as 67122-1-PBS)

  0.25 μL mouse serum was subjected to SDS-PAGE followed by western blot with 67122-1-Ig and isotype control antibody 66360-1-Ig at dilution of 1:10000 incubated at room temperature for 1.5 hours. HRP-goat anti-mouse kappa chain secondary antibody was used for detection. . This data was developed using the same antibody clone with 67122-1-PBS in a different storage buffer formulation.

mFC tag Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67122-1-PBS

Clone No.2F5A2

Host / Isotype

Mouse / IgG1

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

FC tag

---

Product Information

67122-1-PBS targets mFC tag in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27844

  Product name: Recombinant mouse FC tag protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-232 aa of

  Sequence: PRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK

• Full Name: mFC tag
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 25-30 kDa
• RRID: AB_2918482
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

This antibody detects the mouse Fc tag. It's mouse Fc gamma 2a.