FCER1G Recombinant monoclonal antibody, PBS Only

FCER1G Uni-rAb® Recombinant Antibody for IF/ICC, Indirect ELISA
Cat No. 85390-1-PBS
Clone No.242829C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, Indirect ELISA

242829C5, Fc epsilon RI gamma, Fc receptor gamma-chain, Fc-epsilon RI-gamma, FceRI gamma

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85390-1-PBS targets FCER1G in IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4442

Product name: Recombinant human FCER1G protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-87 aa of BC033872

Sequence: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Predict reactive species
Full Name Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
Calculated Molecular Weight 87 aa, 10 kDa
GenBank Accession NumberBC033872
Gene Symbol FcRγ
Gene ID (NCBI) 2207
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP30273
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FCER1G (Fc receptor gamma-chain, FcRgamma), also known as Fc-epsilon RI-gamma, or IgE Fc receptor subunit gamma (FceRI gamma), is a component of the high-affinity immunoglobulin E (IgE) receptor (Fc epsilon RI) which is a tetrameric complex of one alpha subunit, one beta subunit, and two disulfide-linked gamma subunits (PMID: 2146219; 2531187). Fc epsilon RI is present exclusively on mast cells and basophils, mediating allergic inflammatory signaling (PMID: 17438574). FCER1G is widely expressed and contains an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors (PMID: 19098920).

Loading...
||
New chat Able
正在加载,请稍候...