CoraLite® Plus 488-conjugated FCER1G Recombinant monoclonal antibody

• 

  IF Staining of RAW 264.7 using CL488-85390

  Immunofluorescent analysis of (4% PFA) fixed RAW 264.7 cells using CoraLite® Plus 488 FCER1G antibody (CL488-85390, Clone: 242829C5 ) at dilution of 1:500.

FCER1G Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-85390

Clone No.242829C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

242829C5, Fc epsilon RI gamma, Fc receptor gamma-chain, Fc-epsilon RI-gamma, FceRI gamma

---

Tested Applications

• Positive IF/ICC detected in: RAW 264.7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85390 targets FCER1G in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4442

  Product name: Recombinant human FCER1G protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-87 aa of BC033872

  Sequence: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

• Full Name: Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
• Calculated Molecular Weight: 87 aa, 10 kDa
• GenBank Accession Number: BC033872
• Gene Symbol: FcRγ
• Gene ID (NCBI): 2207
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30273
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FCER1G (Fc receptor gamma-chain, FcRgamma), also known as Fc-epsilon RI-gamma, or IgE Fc receptor subunit gamma (FceRI gamma), is a component of the high-affinity immunoglobulin E (IgE) receptor (Fc epsilon RI) which is a tetrameric complex of one alpha subunit, one beta subunit, and two disulfide-linked gamma subunits (PMID: 2146219; 2531187). Fc epsilon RI is present exclusively on mast cells and basophils, mediating allergic inflammatory signaling (PMID: 17438574). FCER1G is widely expressed and contains an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors (PMID: 19098920).