CoraLite® Plus 488-conjugated FCER1G Recombinant monoclonal antibody

FCER1G Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-85390
Clone No.242829C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

242829C5, Fc epsilon RI gamma, Fc receptor gamma-chain, Fc-epsilon RI-gamma, FceRI gamma

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inRAW 264.7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85390 targets FCER1G in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4442

Product name: Recombinant human FCER1G protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-87 aa of BC033872

Sequence: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Predict reactive species
Full Name Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
Calculated Molecular Weight 87 aa, 10 kDa
GenBank Accession NumberBC033872
Gene Symbol FcRγ
Gene ID (NCBI) 2207
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP30273
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FCER1G (Fc receptor gamma-chain, FcRgamma), also known as Fc-epsilon RI-gamma, or IgE Fc receptor subunit gamma (FceRI gamma), is a component of the high-affinity immunoglobulin E (IgE) receptor (Fc epsilon RI) which is a tetrameric complex of one alpha subunit, one beta subunit, and two disulfide-linked gamma subunits (PMID: 2146219; 2531187). Fc epsilon RI is present exclusively on mast cells and basophils, mediating allergic inflammatory signaling (PMID: 17438574). FCER1G is widely expressed and contains an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors (PMID: 19098920).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 FCER1G antibody CL488-85390Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...