FCN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FCN1 Polyclonal antibody, PBS Only (11775-1-PBS)

• 

  WB analysis using 11775-1-AP (same clone as 11775-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11775-1-AP (FCN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11775-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 11775-1-AP (same clone as 11775-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 11775-1-AP (FCN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11775-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 11775-1-AP (same clone as 11775-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 11775-1-AP (FCN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11775-1-PBS in a different storage buffer formulation.

FCN1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 11775-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

11775-1-PBS targets FCN1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2444

  Product name: Recombinant human FCN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-326 aa of BC020635

  Sequence: MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA

• Full Name: ficolin (collagen/fibrinogen domain containing) 1
• Calculated Molecular Weight: 326 aa, 35 kDa
• Observed Molecular Weight: 33-37 kDa
• GenBank Accession Number: BC020635
• Gene Symbol: FCN1
• Gene ID (NCBI): 2219
• RRID: AB_2104288
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00602
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.