Use Able AI chat for product recommendations

Ficolin 3 Polyclonal antibody

Ficolin 3 Polyclonal Antibody for WB, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Ficolin-3, Collagen/fibrinogen domain-containing lectin 3 p35, Collagen/fibrinogen domain-containing protein 3, FCN3, FCNH

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Ficolin 3 in ?

Tested Applications

Positive WB detected inhuman plasma
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11867-1-AP targets Ficolin 3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2449

Product name: Recombinant human FCN3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 20-288 aa of BC020731

Sequence: CLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR

Predict reactive species
Full Name ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC020731
Gene Symbol Ficolin-3
Gene ID (NCBI) 8547
RRIDAB_2104432
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75636
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ficolins are a group of oligomeric lectins with subunits consisting of both collagen-like and fibrinogen-like domains (PMID: 20375620). They are innate pattern recognition receptors and play integral roles within the innate immune response. In humans, there are three ficolins termed M-, L-, and H-ficolin (also referred to as ficolin-1, -2, and -3) whereas rodents only possess ficolin-A and -B, which are the orthologues of human L- and M-ficolin, respectively (PMID: 30868077). Ficolin-3 (Hakata antigen or H-ficolin) was initially identified based on its reactivity with sera from patients with systemic lupus erythematosus (PMID: 1859827). It has been shown to have a calcium-independent lectin activity. Ficolin-3 is associated with MASPs and sMAP, and which activates the lectin pathway (PMID: 11907111). Ficolin-3 shows affinity for GalNAc, GlcNAc, D-fucose and galactose (PMID: 30868077).

Protocols

Product Specific Protocols
IF protocol for Ficolin 3 antibody 11867-1-APDownload protocol
WB protocol for Ficolin 3 antibody 11867-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The Ficolin 3 Polyclonal antibody (Cat# 11867-1-AP) has 5 citations published in Nature Communications, Journal of Experimental & Clinical Cancer Research, Cell Oncology, Frontiers in Molecular Biosciences, and International Journal of Medical Sciences. Research fields include oxidative stress and brain homeostasis after spaceflight, ferroptosis and N-glycosylation in hepatocellular carcinoma, Wnt/β-catenin signaling in HCC progression, aging-related gene signatures in ischemic cardiomyopathy, and ficolin-3 expression as a prognostic marker in liver cancer.

SpeciesApplicationTitle
humanWB

Nat Commun

Secretome profiling reveals acute changes in oxidative stress, brain homeostasis, and coagulation following short-duration spaceflight

Authors - Nadia Houerbi
mouse,humanWB,IHC

J Exp Clin Cancer Res

Ficolin 3 promotes ferroptosis in HCC by downregulating IR/SREBP axis-mediated MUFA synthesis

Authors - Yanmei Yuan
humanIHC,IF

Cell Oncol (Dordr)

STT3A-mediated FCN3 N-glycosylation promotes Treg cell activation to drive hepatocellular carcinoma progression via Wnt/β-catenin.

Authors - Hongli Zhang
  • KD Validated
rat,humanWB

Front Mol Biosci

Integrated Strategies of Diverse Feature Selection Methods Identify Aging-Based Reliable Gene Signatures for Ischemic Cardiomyopathy.

Authors - Huafeng Song
humanIHC

Int J Med Sci

Loss of ficolin-3 expression is associated with poor prognosis in patients with hepatocellular carcinoma

Authors - Chia-Chi Chen
Loading...
||
New chat

Able™

正在加载,请稍候...