CoraLite® Plus 488-conjugated Ficolin-3 Polyclonal antibody

Ficolin-3 Polyclonal Antibody for IF/ICC
Cat No. CL488-11867

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

FCN3, FCNH, Ficolin 3, Ficolin-3, HAKA1, Hakata antigen

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11867 targets Ficolin-3 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2449

Product name: Recombinant human FCN3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 20-288 aa of BC020731

Sequence: CLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR

Predict reactive species
Full Name ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC020731
Gene Symbol Ficolin-3
Gene ID (NCBI) 8547
RRIDAB_3672516
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO75636
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Ficolins are a group of oligomeric lectins with subunits consisting of both collagen-like and fibrinogen-like domains (PMID: 20375620). They are innate pattern recognition receptors and play integral roles within the innate immune response. In humans, there are three ficolins termed M-, L-, and H-ficolin (also referred to as ficolin-1, -2, and -3) whereas rodents only possess ficolin-A and -B, which are the orthologues of human L- and M-ficolin, respectively (PMID: 30868077). Ficolin-3 (Hakata antigen or H-ficolin) was initially identified based on its reactivity with sera from patients with systemic lupus erythematosus (PMID: 1859827). It has been shown to have a calcium-independent lectin activity. Ficolin-3 is associated with MASPs and sMAP, and which activates the lectin pathway (PMID: 11907111). Ficolin-3 shows affinity for GalNAc, GlcNAc, D-fucose and galactose (PMID: 30868077).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 Ficolin-3 antibody CL488-11867Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...