FCRL1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• FCRL1 Polyclonal antibody (33184-1-AP)

• 

  WB analysis of Raji using 33184-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 33184-1-AP (FCRL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

FCRL1 Polyclonal Antibody for WB, ELISA

Cat No. 33184-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CD307a, Fc receptor-like protein 1, FcRH1, FcR-like protein 1, IFGP family protein 1

---

Tested Applications

• Positive WB detected in: Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33184-1-AP targets FCRL1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg3713

  Product name: Recombinant Human FCRL1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 17-307 aa of BC033690

  Sequence: AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSNHLTS

• Full Name: Fc receptor-like 1
• Calculated Molecular Weight: 429 aa, 47 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC033690
• Gene Symbol: FCRL1
• Gene ID (NCBI): 115350
• RRID: AB_3742884
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96LA6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fc receptor-like protein 1 (FCRL1) is a type I transmembrane glycoprotein that plays a crucial role in regulating B-cell receptor (BCR)-mediated signaling responses (PMID:15479727). It contains intracellular tyrosine-based motifs that can modulate BCR signaling, leading to changes in calcium flux, proliferation, and antibody production (PMID: 37822931). FCRL1 is involved in regulating B-cell development and activation, with its signaling pathways influencing ERK activation through interactions with proteins such as GRB2. This regulation is essential for maintaining B-cell homeostasis and preventing the development of autoreactive B cells (PMID: 34697226).