FCRL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FCRL1 Polyclonal antibody, PBS Only (33184-1-PBS)

• 

  WB analysis of Raji using 33184-1-AP (same clone as 33184-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 33184-1-AP (FCRL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33184-1-PBS in a different storage buffer formulation.

FCRL1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33184-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CD307a, Fc receptor-like protein 1, FcRH1, FcR-like protein 1, IFGP family protein 1

---

Product Information

33184-1-PBS targets FCRL1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg3713

  Product name: Recombinant Human FCRL1 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 17-307 aa of BC033690

  Sequence: AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSNHLTS

• Full Name: Fc receptor-like 1
• Calculated Molecular Weight: 429 aa, 47 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC033690
• Gene Symbol: FCRL1
• Gene ID (NCBI): 115350
• RRID: AB_3742884
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96LA6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fc receptor-like protein 1 (FCRL1) is a type I transmembrane glycoprotein that plays a crucial role in regulating B-cell receptor (BCR)-mediated signaling responses (PMID:15479727). It contains intracellular tyrosine-based motifs that can modulate BCR signaling, leading to changes in calcium flux, proliferation, and antibody production (PMID: 37822931). FCRL1 is involved in regulating B-cell development and activation, with its signaling pathways influencing ERK activation through interactions with proteins such as GRB2. This regulation is essential for maintaining B-cell homeostasis and preventing the development of autoreactive B cells (PMID: 34697226).