Use Able AI chat for product recommendations

FECH Polyclonal antibody

FECH Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, ELISA

EC:4.98.1.1, EPP, EPP1, FCE, Protoheme ferro-lyase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for FECH in ?

Tested Applications

Positive WB detected inmouse heart tissue, HepG2 cells, human heart tissue, human liver tissue, K-562 cells, mouse kidney tissue, mouse liver tissue, rat heart tissue, rat liver tissue
Positive IHC detected inhuman heart tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:100-1:400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14466-1-AP targets FECH in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5814

Product name: Recombinant human FECH protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 60-423 aa of BC039841

Sequence: VQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL

Predict reactive species
Full Name ferrochelatase (protoporphyria)
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 40-48 kDa
GenBank Accession NumberBC039841
Gene Symbol FECH
Gene ID (NCBI) 2235
RRIDAB_2231579
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP22830
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FECH(ferrochelatase, mitochondrial ) is also named as heme synthase, protoheme ferro-lyase and belongs to the ferrochelatase family. It is a homodimeric (86 kDa) mitochondrial membrane-associated enzyme that catalyzes the insertion of ferrous iron into protoporphyrin to form heme(PMID:11175906). It has 2 isoforms produced by alternative splicing and the full length protein has a transit peptide with 54 amino acids.

Protocols

Product Specific Protocols
IHC protocol for FECH antibody 14466-1-APDownload protocol
WB protocol for FECH antibody 14466-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The antibody targeting SLC25A39 (catalog no. 14466-1-AP) has 33 citations across journals including Nature, Science, Cell Metabolism, Cancer Discovery, Nature Metabolism, Nature Communications, Molecular Cell, Journal of Clinical Investigation, and Cell Reports. Research fields span mitochondrial glutathione import, iron-sulfur cluster biogenesis, heme metabolism, ferroptosis, cancer biology, cardiovascular disease, neurodegeneration, and erythropoiesis.

SpeciesApplicationTitle
humanWB

Nature

An ancient mitochondrial program tunes translation to haem availability

Authors - Xiang Zhang
humanWB

Nature

SLC25A39 is necessary for mitochondrial glutathione import in mammalian cells.

Authors - Ying Wang
humanWB

Science

Autoregulatory control of mitochondrial glutathione homeostasis

Authors - Yuyang Liu
humanWB

Cell Metab

Iron-addicted colorectal cancers exploit heme-complex II axis to resist oxidative cell death.

Authors - Chesta Jain
humanWB

Cell Metab

A Single Adaptable Cochaperone-Scaffold Complex Delivers Nascent Iron-Sulfur Clusters to Mammalian Respiratory Chain Complexes I-III.

Authors - Nunziata Maio
humanWB

Cancer Discov

NCOA4-Mediated Ferritinophagy Is a Pancreatic Cancer Dependency via Maintenance of Iron Bioavailability for Iron-Sulfur Cluster Proteins

Authors - Naiara Santana-Codina

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers gave 5-star ratings for Western Blot applications. One user successfully detected the target in murine liver whole organ homogenates using a 1:800 dilution with 5% milk/TBST, reporting that the antibody "worked very well" with 30 µg of lysate. The other user applied it to human cell lines at a 1:1000 dilution, incubating the primary antibody overnight at 4°C followed by a rabbit secondary antibody for 2 hours at room temperature. Overall, users report reliable performance across species and tissue types with straightforward protocols.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Sofia (Verified Customer) (06-25-2025)

The antibody worked very well in western immunoblotting using 30µg liver lysates of murine origin.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 to 800, 5% milk/TBST
  • Cell Tissue Type: murine liver whole organ homogenates

Marina (Verified Customer) (07-24-2024)

Incubation with primary antibody ON at 4C. Incubation with secondary antibody (rabbit) for 2h at RT.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human cell lines
Loading...
||
New chat

Able™

正在加载,请稍候...