Tested Applications
| Positive WB detected in | mouse heart tissue, HepG2 cells, human heart tissue, human liver tissue, K-562 cells, mouse kidney tissue, mouse liver tissue, rat heart tissue, rat liver tissue |
| Positive IHC detected in | human heart tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14466-1-AP targets FECH in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5814 Product name: Recombinant human FECH protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 60-423 aa of BC039841 Sequence: VQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL Predict reactive species |
| Full Name | ferrochelatase (protoporphyria) |
| Calculated Molecular Weight | 48 kDa |
| Observed Molecular Weight | 40-48 kDa |
| GenBank Accession Number | BC039841 |
| Gene Symbol | FECH |
| Gene ID (NCBI) | 2235 |
| RRID | AB_2231579 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P22830 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FECH(ferrochelatase, mitochondrial ) is also named as heme synthase, protoheme ferro-lyase and belongs to the ferrochelatase family. It is a homodimeric (86 kDa) mitochondrial membrane-associated enzyme that catalyzes the insertion of ferrous iron into protoporphyrin to form heme(PMID:11175906). It has 2 isoforms produced by alternative splicing and the full length protein has a transit peptide with 54 amino acids.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FECH antibody 14466-1-AP | Download protocol |
| WB protocol for FECH antibody 14466-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The antibody targeting SLC25A39 (catalog no. 14466-1-AP) has 33 citations across journals including Nature, Science, Cell Metabolism, Cancer Discovery, Nature Metabolism, Nature Communications, Molecular Cell, Journal of Clinical Investigation, and Cell Reports. Research fields span mitochondrial glutathione import, iron-sulfur cluster biogenesis, heme metabolism, ferroptosis, cancer biology, cardiovascular disease, neurodegeneration, and erythropoiesis.
| Species | Application | Title |
|---|---|---|
Cell Metab Iron-addicted colorectal cancers exploit heme-complex II axis to resist oxidative cell death. | ||
Cell Metab A Single Adaptable Cochaperone-Scaffold Complex Delivers Nascent Iron-Sulfur Clusters to Mammalian Respiratory Chain Complexes I-III. | ||
Cancer Discov NCOA4-Mediated Ferritinophagy Is a Pancreatic Cancer Dependency via Maintenance of Iron Bioavailability for Iron-Sulfur Cluster Proteins |
Reviews
What customers say
Both reviewers gave 5-star ratings for Western Blot applications. One user successfully detected the target in murine liver whole organ homogenates using a 1:800 dilution with 5% milk/TBST, reporting that the antibody "worked very well" with 30 µg of lysate. The other user applied it to human cell lines at a 1:1000 dilution, incubating the primary antibody overnight at 4°C followed by a rabbit secondary antibody for 2 hours at room temperature. Overall, users report reliable performance across species and tissue types with straightforward protocols.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sofia (Verified Customer) (06-25-2025) | The antibody worked very well in western immunoblotting using 30µg liver lysates of murine origin.
|
Marina (Verified Customer) (07-24-2024) | Incubation with primary antibody ON at 4C. Incubation with secondary antibody (rabbit) for 2h at RT.
|
