FER Monoclonal antibody

• Home
• Products
• Primary Antibodies
• FER Monoclonal antibody (67671-1-Ig)

FER Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67671-1-Ig Copied!

Clone No. 1E3H2

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA
For FC, select conjugated version.

Synonyms

1E3H2, EC:2.7.10.2, Feline encephalitis virus-related kinase FER, Fujinami poultry sarcoma/Feline sarcoma-related protein Fer, p94 Fer

• 

  WB analysis using 67671-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67671-1-Ig (FER antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of ROS1728 using 67671-1-Ig

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 67671-1-Ig (FER antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of 4T1 using 67671-1-Ig

  4T1 cells were subjected to SDS PAGE followed by western blot with 67671-1-Ig (FER antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of NIH/3T3 using 67671-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using FER antibody (67671-1-Ig, Clone: 1E3H2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for FER in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: LNCaP cells, ROS1728 cells, 4T1 cells, HEK-293 cells, Hela cells, HepG2 cells, Jurkat cells, K-562 cells, NIH/3T3 cells
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67671-1-Ig targets FER in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19176

  Product name: Recombinant human FER protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 96-445 aa of BC017060

  Sequence: PLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALS

• Full Name: fer (fps/fes related) tyrosine kinase
• Calculated Molecular Weight: 822 aa, 95 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: BC017060
• Gene Symbol: FER
• Gene ID (NCBI): 2241
• RRID: AB_2882867
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16591
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FER(Tyrosine-protein kinase Fer) is also named as TYK3 and belongs to the protein kinase superfamily. Tyrosine-protein kinase acts downstream of cell surface receptors for growth factors and plays a role in the regulation of the actin cytoskeleton, microtubule assembly, lamellipodia formation, cell adhesion, cell migration and chemotaxis. This protein has 3 isoforms produced by alternative promoter usage and alternative splicing.

Publications

What published studies show

The FER Monoclonal antibody (1E3H2), catalog number 67671-1-Ig, has a total of 1 citation. It was cited in Cell Reports (2025) in a study on colorectal cancer progression involving THBS2-producing matrix CAFs and the CD47-MAPK axis. The research field is oncology/cancer biology, specifically tumor microenvironment and signaling pathways in colorectal cancer.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep; THBS2-producing matrix CAFs promote colorectal cancer progression and link to poor prognosis via the CD47-MAPK axis; Authors - Zaoqu Liu