FER Monoclonal antibody, PBS Only

• 

  WB analysis using 67671-1-Ig (same clone as 67671-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67671-1-Ig (FER antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 67671-1-PBS in a different storage buffer formulation.

• 

  WB analysis of ROS1728 using 67671-1-Ig (same clone as 67671-1-PBS)

  ROS1728 cells were subjected to SDS PAGE followed by western blot with 67671-1-Ig (FER antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67671-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67671-1-Ig (same clone as 67671-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67671-1-Ig (FER antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67671-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 67671-1-Ig (same clone as 67671-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using FER antibody (67671-1-Ig, Clone: 1E3H2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67671-1-PBS in a different storage buffer formulation.

FER Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67671-1-PBS

Clone No.1E3H2

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

FER, p94 Fer, Proto oncogene c Fer, TYK3, Tyrosine kinase 3, Tyrosine protein kinase Fer

---

Product Information

67671-1-PBS targets FER in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19176

  Product name: Recombinant human FER protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 96-445 aa of BC017060

  Sequence: PLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKCSYRQLIKEMNSAKEKYKEALAKGKETEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALS

• Full Name: fer (fps/fes related) tyrosine kinase
• Calculated Molecular Weight: 822 aa, 95 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: BC017060
• Gene Symbol: FER
• Gene ID (NCBI): 2241
• RRID: AB_2882867
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P16591
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FER(Tyrosine-protein kinase Fer) is also named as TYK3 and belongs to the protein kinase superfamily. Tyrosine-protein kinase acts downstream of cell surface receptors for growth factors and plays a role in the regulation of the actin cytoskeleton, microtubule assembly, lamellipodia formation, cell adhesion, cell migration and chemotaxis. This protein has 3 isoforms produced by alternative promoter usage and alternative splicing.