Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13784-1-AP targets FGF12 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4797 Product name: Recombinant human FGF12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC022524 Sequence: MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST Predict reactive species |
| Full Name | fibroblast growth factor 12 |
| Calculated Molecular Weight | 181 aa, 20 kDa |
| Observed Molecular Weight | 20-22 kDa |
| GenBank Accession Number | BC022524 |
| Gene Symbol | FGF12 |
| Gene ID (NCBI) | 2257 |
| RRID | AB_2103928 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61328 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FGF12 is a member of the FGF family. FGF family members play important roles in embryogenesis, angiogenesis, and wound repair. FGF12 lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. FGF12 plays an intracellular role in the inhibition of radiation-induced apoptosis. FGF12 is expressed abundantly in developing and adult nervous systems; therefore, FGF12 was thought to be related to nervous system development and function.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FGF12 antibody 13784-1-AP | Download protocol |
| IP protocol for FGF12 antibody 13784-1-AP | Download protocol |
| WB protocol for FGF12 antibody 13784-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-FGF12 antibody (Cat# 13784-1-AP) has 6 total citations published in Nature Communications, Neurobiology of Disease, Cells, Epilepsia, Scientific Reports, and Heliyon. Research fields span neurodevelopmental disorders (autism), vestibular and auditory function, ototoxicity, epilepsy, prostate cancer, and gastric cancer. Applications include WB, IF, and IHC across mouse, rat, and human species.
| Species | Application | Title |
|---|---|---|
Nat Commun Proximity analysis of native proteomes reveals phenotypic modifiers in a mouse model of autism and related neurodevelopmental conditions | ||
Neurobiol Dis Decreased expression of synaptic genes in the vestibular ganglion of rodents following subchronic ototoxic stress | ||
Epilepsia Early onset epilepsy and sudden unexpected death in epilepsy with cardiac arrhythmia in mice carrying the early infantile epileptic encephalopathy 47 gain-of-function FHF1(FGF12) missense mutation. | ||
Sci Rep Fibroblast growth factor 12 is expressed in spiral and vestibular ganglia and necessary for auditory and equilibrium function.
| ||
Heliyon Identification of cancer-associated fibroblast-related Ectodysplasin-A as a novel indicator for prognosis and immune response in gastric cancer |
