FGF12 Polyclonal antibody, PBS Only

• 

  WB analysis using 13784-1-AP (same clone as 13784-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13784-1-AP (FGF12 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13784-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 13784-1-AP (same clone as 13784-1-PBS)

  IP result of anti-FGF12 (IP:13784-1-AP, 4ug; Detection:13784-1-AP 1:6000) with mouse brain tissue lysate 1280 ug. This data was developed using the same antibody clone with 13784-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13784-1-AP (same clone as 13784-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13784-1-AP (FGF12 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13784-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13784-1-AP (same clone as 13784-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13784-1-AP (FGF12 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13784-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FGF12 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13784-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

FGF-12, FGF 12, FHF1, FHF-1, Myocyte-activating factor

---

Product Information

13784-1-PBS targets FGF12 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4797

  Product name: Recombinant human FGF12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-181 aa of BC022524

  Sequence: MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

• Full Name: fibroblast growth factor 12
• Calculated Molecular Weight: 181 aa, 20 kDa
• Observed Molecular Weight: 20-22 kDa
• GenBank Accession Number: BC022524
• Gene Symbol: FGF12
• Gene ID (NCBI): 2257
• RRID: AB_2103928
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61328
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FGF12 is a member of the FGF family. FGF family members play important roles in embryogenesis, angiogenesis, and wound repair. FGF12 lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. FGF12 plays an intracellular role in the inhibition of radiation-induced apoptosis. FGF12 is expressed abundantly in developing and adult nervous systems; therefore, FGF12 was thought to be related to nervous system development and function.