FGFBP3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FGFBP3 Polyclonal antibody, PBS Only (24725-1-PBS)

• 

  WB analysis using 24725-1-AP (same clone as 24725-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24725-1-AP (FGFBP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24725-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 24725-1-AP (same clone as 24725-1-PBS)

  Immunofluorescent analysis of A431 cells using 24725-1-AP (FGFBP3 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24725-1-PBS in a different storage buffer formulation.

FGFBP3 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 24725-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

24725-1-PBS targets FGFBP3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20573

  Product name: Recombinant human FGFBP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-258 aa of BC025966

  Sequence: MTPPKLRASLSPSLLLLLSGCLLAAARREKGAASNVAEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPEAAAGSELALRCQSPDGARHQCAYRGHPERCAAYAARRAHFWKQVLGGLRKKRRPCHDPAPLQARLCAGKKGHGAELRLVPRASPPARPTVAGFAGESKPRARNRGRTRERASGPAAGTPPPQSAPPKENPSERKTNEGKRKAALVPNEERPMGTGPDPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG

• Full Name: fibroblast growth factor binding protein 3
• Calculated Molecular Weight: 258 aa, 28 kDa
• Observed Molecular Weight: 60-65 kda
• GenBank Accession Number: BC025966
• Gene Symbol: FGFBP3
• Gene ID (NCBI): 143282
• RRID: AB_2879691
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAT2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FGFBP3 also named as C10orf13 or FGF binding protein 3 is 258 amino acid protein, which belongs to the fibroblast growth factor binding family. FGFBP3 is a secreted protein and may play a role in the regulation of gene transcription. The molecular weight of FGFBP3 is 29kDa, but our results detected the 60-65kDa protein by western blot. We infer that FGFBP3 may exist as dimer.