FGL1 Monoclonal antibody, PBS Only

• 

  WB analysis of pig liver using 67391-1-Ig (same clone as 67391-1-PBS)

  pig liver tissue were subjected to SDS PAGE followed by western blot with 67391-1-Ig (FGL1 antibody) at dilution of 1:2700 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67391-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 67391-1-Ig (same clone as 67391-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67391-1-Ig (FGL1 antibody) at dilution of 1:2700 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67391-1-Ig (same clone as 67391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67391-1-Ig (FGL1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 67391-1-Ig (same clone as 67391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67391-1-Ig (FGL1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 67391-1-Ig (same clone as 67391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 67391-1-Ig (FGL1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 67391-1-Ig (same clone as 67391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 67391-1-Ig (FGL1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67391-1-Ig (same clone as 67391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67391-1-Ig (FGL1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67391-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67391-1-Ig (same clone as 67391-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67391-1-Ig (FGL1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67391-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67391-1-Ig (same clone as 67391-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using FGL1 antibody (67391-1-Ig, Clone: 2B11C6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67391-1-PBS in a different storage buffer formulation.

FGL1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67391-1-PBS

Clone No.2B11C6

Host / Isotype

Mouse / IgG1

Reactivity

Human, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FGL1, fibrinogen like 1, Fibrinogen like protein 1, Hepassocin, HFREP 1, HFREP1, HP 041, LFIRE 1, LFIRE1

---

Product Information

67391-1-PBS targets FGL1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, pig samples.

• Tested Reactivity: Human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8581

  Product name: Recombinant human FGL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-312 aa of BC007047

  Sequence: MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

• Full Name: fibrinogen-like 1
• Calculated Molecular Weight: 312 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC007047
• Gene Symbol: FGL1
• Gene ID (NCBI): 2267
• RRID: AB_2882635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q08830
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fibrinogen-like 1 (FGL1), also termed hepatocyte-derived fibrinogen-related protein 1 (HFREP1) or hepassocin, is a predominantly liver expressed protein that has been implicated as both a hepatoprotectant and a hepatocyte mitogen. FGL1 expression is decreased in hepatocellular carcinoma (HCC), and it may play a role in the development of hepatocellular carcinomas.