FGL1 Monoclonal antibody

• 

  WB analysis of pig liver using 67391-1-Ig

  pig liver tissue were subjected to SDS PAGE followed by western blot with 67391-1-Ig (FGL1 antibody) at dilution of 1:2700 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 67391-1-Ig

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67391-1-Ig (FGL1 antibody) at dilution of 1:2700 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 67391-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67391-1-Ig (FGL1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 67391-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 67391-1-Ig (FGL1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 67391-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 67391-1-Ig (FGL1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 67391-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 67391-1-Ig (FGL1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67391-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67391-1-Ig (FGL1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67391-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67391-1-Ig (FGL1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 67391-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using FGL1 antibody (67391-1-Ig, Clone: 2B11C6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

FGL1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67391-1-Ig

Clone No.2B11C6

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

Human, pig and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FGL1, fibrinogen like 1, Fibrinogen like protein 1, Hepassocin, HFREP 1, HFREP1, HP 041, LFIRE 1, LFIRE1

---

Tested Applications

• Positive WB detected in: pig liver tissue, human placenta tissue
• Positive IHC detected in: human liver tissue, human lung tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5400
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67391-1-Ig targets FGL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, pig samples.

• Tested Reactivity: Human, pig
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8581

  Product name: Recombinant human FGL1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-312 aa of BC007047

  Sequence: MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

• Full Name: fibrinogen-like 1
• Calculated Molecular Weight: 312 aa, 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC007047
• Gene Symbol: FGL1
• Gene ID (NCBI): 2267
• RRID: AB_2882635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q08830
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fibrinogen-like 1 (FGL1), also termed hepatocyte-derived fibrinogen-related protein 1 (HFREP1) or hepassocin, is a predominantly liver expressed protein that has been implicated as both a hepatoprotectant and a hepatocyte mitogen. FGL1 expression is decreased in hepatocellular carcinoma (HCC), and it may play a role in the development of hepatocellular carcinomas.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Ther Oncolytics; Dual-targeting vaccine of FGL1/CAIX exhibits potent anti-tumor activity by activating DC-mediated multi-functional CD8 T cell immunity; Authors - Dafei Chai