FGL1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86426-2-RR (same clone as 86426-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86426-2-RR (FGL1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86426-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 86426-2-RR (same clone as 86426-2-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 86426-2-RR (FGL1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86426-2-PBS in a different storage buffer formulation.

FGL1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86426-2-PBS

Clone No.251192B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Hepassocin, fibrinogen like 1, Fibrinogen like protein 1, Fibrinogen-like protein 1, Hepatocyte-derived fibrinogen-related protein 1

---

Product Information

86426-2-PBS targets FGL1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2765

  Product name: Recombinant Human FGL1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 23-312 aa of NM_004467.4

  Sequence: LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI

• Full Name: fibrinogen-like 1
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: NM_004467.4
• Gene Symbol: FGL1
• Gene ID (NCBI): 2267
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q08830
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FGL1 is a 68 kDa protein that comprises two disulfide linked 34 kDa homodimers. FGL1 is a predominantly liver expressed protein that has been implicated as both a hepatoprotectant and a hepatocyte mitogen. FGL1 expression is decreased in hepatocellular carcinoma (HCC), and it may play a role in the development of hepatocellular carcinomas.