FHL2 Recombinant monoclonal antibody

FHL2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, ELISA
Cat No. 86060-1-RR
Clone No.250585E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

AAG11, DRAL, FHL 2, FHL-2, LIM domain protein DRAL

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, PANC-1 cells, U2OS cells, hTERT-RPE1 cells, MG-63 cells, NIH/3T3 cells
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86060-1-RR targets FHL2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29655

Product name: Recombinant human FHL2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-279 aa of BC014397

Sequence: MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI

Predict reactive species
Full Name four and a half LIM domains 2
Calculated Molecular Weight 32 kDa
Observed Molecular Weight30-32 kDa
GenBank Accession NumberBC014397
Gene Symbol FHL2
Gene ID (NCBI) 2274
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14192
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FHL2(Four and a half LIM domains protein 2), also known as DRAL. It is located in cytoplasm and nucleus. The protein is expressed in skeletal muscle and heart. May function as a molecular transmitter linking various signaling pathways to transcriptional regulation. Negatively regulates the transcriptional repressor E4F1 and may function in cell growth. Inhibits the transcriptional activity of FOXO1 and its apoptotic function by enhancing the interaction of FOXO1 with SIRT1 and FOXO1 deacetylation. Negatively regulates the calcineurin/NFAT signaling pathway in cardiomyocytes (PMID: 28717008). The molecular weight of FHL2 is 32 kDa.

Protocols

Product Specific Protocols
IF protocol for FHL2 antibody 86060-1-RRDownload protocol
WB protocol for FHL2 antibody 86060-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...