CoraLite® Plus 488-conjugated FHL2 Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-86060

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 FHL2 antibody (CL488-86060, Clone: 250585E1 ) at dilution of 1:200, CL594-phalloidin (red).

• 

  IF Staining of HSkMC using CL488-86060

  Immunofluorescent analysis of (4% PFA) fixed HSkMC cells using CoraLite® Plus 488 FHL2 antibody (CL488-86060, Clone: 250585E1 ) at dilution of 1:200.

FHL2 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-86060

Clone No.250585E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

AAG11, DRAL, FHL 2, FHL-2, LIM domain protein DRAL

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells, HSkMC cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86060 targets FHL2 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29655

  Product name: Recombinant human FHL2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-279 aa of BC014397

  Sequence: MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI

• Full Name: four and a half LIM domains 2
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 30-32 kDa
• GenBank Accession Number: BC014397
• Gene Symbol: FHL2
• Gene ID (NCBI): 2274
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14192
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FHL2(Four and a half LIM domains protein 2), also known as DRAL. It is located in cytoplasm and nucleus. The protein is expressed in skeletal muscle and heart. May function as a molecular transmitter linking various signaling pathways to transcriptional regulation. Negatively regulates the transcriptional repressor E4F1 and may function in cell growth. Inhibits the transcriptional activity of FOXO1 and its apoptotic function by enhancing the interaction of FOXO1 with SIRT1 and FOXO1 deacetylation. Negatively regulates the calcineurin/NFAT signaling pathway in cardiomyocytes (PMID: 28717008). The molecular weight of FHL2 is 32 kDa.