FKBP14 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FKBP14 Polyclonal antibody, PBS Only (15884-1-PBS)

• 

  WB analysis of HEK-293 using 15884-1-AP (same clone as 15884-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 15884-1-AP (FKBP14 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15884-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 15884-1-AP (same clone as 15884-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 15884-1-AP (FKBP14 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15884-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15884-1-AP (same clone as 15884-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15884-1-AP (FKBP14 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15884-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 15884-1-AP (same clone as 15884-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 15884-1-AP (FKBP14 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15884-1-PBS in a different storage buffer formulation.

FKBP14 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15884-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

22 kDa FK506-binding protein, EC:5.2.1.8, FK506-binding protein 14, FKBP-14, FKBP22

---

Product Information

15884-1-PBS targets FKBP14 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8668

  Product name: Recombinant human FKBP14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-211 aa of BC005206

  Sequence: LIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYKHDEL

• Full Name: FK506 binding protein 14, 22 kDa
• Calculated Molecular Weight: 211 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC005206
• Gene Symbol: FKBP14
• Gene ID (NCBI): 55033
• RRID: AB_2102702
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWM8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FKBP14, also named as FKBP22, belongs to the family of FK506-binding peptidyl-prolyl cis-trans isomerases (PPIases). PPIases accelerate the folding of proteins during protein synthesis. FKBP14 is localized in the endoplasmic reticulum (ER) and that deficiency of FKBP14 leads to enlarged ER cisterns in dermal fibroblasts in vivo. FKBP14 is about 22kd.