Tested Applications
| Positive WB detected in | mouse brain tissue, Jurkat cells, rat brain tissue |
| Positive IHC detected in | human normal colon, human colon tissue, human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10273-1-AP targets FKBP1A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0406 Product name: Recombinant human FKBP1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 6-108 aa of BC001925 Sequence: ETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE Predict reactive species |
| Full Name | FK506 binding protein 1A, 12kDa |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC001925 |
| Gene Symbol | FKBP1A |
| Gene ID (NCBI) | 2280 |
| RRID | AB_2231588 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62942 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FKBP1A(FK506-binding protein 1A) is also named as FKBP1, FKBP12 and belongs to the FKBP-type PPIase family.It keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand and catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FKBP1A antibody 10273-1-AP | Download protocol |
| WB protocol for FKBP1A antibody 10273-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FKBP1A Polyclonal antibody (Cat# 10273-1-AP) has 7 citations published in Food Chemistry, Cell Reports, Cell Biology and Toxicology, Oncotarget, Development, International Journal of Medical Sciences, and Molecular Pharmacology. Research fields span meat quality proteomics, primate miRNA regulation, sepsis-induced liver injury, TGF-β signaling in cancer-associated fibroblasts, mouse spermiogenesis, ferroptosis in breast cancer, and opioid receptor pharmacology.
| Species | Application | Title |
|---|---|---|
Food Chem TMT-based quantitative proteomic analysis of porcine muscle associated with postmortem meat quality. | ||
Cell Rep Sequencing of captive target transcripts identifies the network of regulated genes and functions of primate-specific miR-522. | ||
Cell Biol Toxicol Andrographolide ameliorates sepsis-induced acute liver injury by attenuating endoplasmic reticulum stress through the FKBP1A-mediated NOTCH1/AK2 pathway | ||
Oncotarget TGFBR-IDH1-Cav1 axis promotes TGF-β signalling in cancer-associated fibroblast. | ||
Development PFN4 is required for manchette development and acrosome biogenesis during mouse spermiogenesis | ||
Int J Med Sci Integrated analysis of FKBP1A/SLC3A2 axis in everolimus inducing ferroptosis of breast cancer and anti-proliferation of T lymphocyte
|
