FKBP5 Monoclonal antibody, PBS Only

FKBP5 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 67874-1-PBS
Clone No.3B11F3

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

FKBP-51, 3B11F3, 51 kDa FK506-binding protein, 54 kDa progesterone receptor-associated immunophilin, AIG6

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67874-1-PBS targets FKBP5 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5514

Product name: Recombinant human FKBP5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-375 aa of BC042605

Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE

Predict reactive species
Full Name FK506 binding protein 5
Calculated Molecular Weight 457 aa, 51 kDa
Observed Molecular Weight 51 kDa
GenBank Accession NumberBC042605
Gene Symbol FKBP5
Gene ID (NCBI) 2289
RRIDAB_2918632
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13451
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FKBP5, also known as FKBP51, belongs to the family of immunophilins, FK506 binding proteins (FKBPs). FKBP5 is a negative regulator of GR activity and plays a key role in the termination of the stress response by GRs. FKBP5 limits GR function by decreasing ligand-binding sensitivity, thereby delaying nuclear translocation and reducing GR-dependent transcriptional activity. The known functions of FKBP5 include the regulation of steroid hormone receptors, inhibiting apoptosis in cancer cells, promoting Akt1 dephosphorylation, and inhibiting the Akt1 pathways, to name a few. FKBP5 is widely expressed and the calculated molecular weight is 51 kDa (PMID: 21119664, PMID: 34077736, PMID: 37154033).

Loading...
||
New chat Able
正在加载,请稍候...