FKBP5 Monoclonal antibody

• 

  WB analysis using 67874-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67874-1-Ig (FKBP5 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis of rat testis using 67874-1-Ig

  rat testis tissue were subjected to SDS PAGE followed by western blot with 67874-1-Ig (FKBP5 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 67874-1-Ig

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 67874-1-Ig (FKBP5 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 67874-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67874-1-Ig (FKBP5 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 67874-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67874-1-Ig (FKBP5 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 67874-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using FKBP5 antibody (67874-1-Ig, Clone: 3B11F3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

FKBP5 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67874-1-Ig

Clone No.3B11F3

Publications(2)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FKBP-51, 3B11F3, 51 kDa FK506-binding protein, 54 kDa progesterone receptor-associated immunophilin, AIG6

---

Tested Applications

• Positive WB detected in: A549 cells, rat testis tissue, mouse testis tissue, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

67874-1-Ig targets FKBP5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, monkey
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5514

  Product name: Recombinant human FKBP5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-375 aa of BC042605

  Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE

• Full Name: FK506 binding protein 5
• Calculated Molecular Weight: 457 aa, 51 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC042605
• Gene Symbol: FKBP5
• Gene ID (NCBI): 2289
• RRID: AB_2918632
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13451
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FKBP5, also known as FKBP51, belongs to the family of immunophilins, FK506 binding proteins (FKBPs). FKBP5 is a negative regulator of GR activity and plays a key role in the termination of the stress response by GRs. FKBP5 limits GR function by decreasing ligand-binding sensitivity, thereby delaying nuclear translocation and reducing GR-dependent transcriptional activity. The known functions of FKBP5 include the regulation of steroid hormone receptors, inhibiting apoptosis in cancer cells, promoting Akt1 dephosphorylation, and inhibiting the Akt1 pathways, to name a few. FKBP5 is widely expressed and the calculated molecular weight is 51 kDa (PMID: 21119664, PMID: 34077736, PMID: 37154033).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Stem Cell Res Ther; Single-cell sequencing of facial adipose tissue unveils FKBP5 as a therapeutic target for facial infiltrating lipomatosis; Authors - Hongrui Chen ; KD Validated
monkey	WB,IF	Neurosci Bull; Single-Nucleus Transcriptomics of the Nucleus Accumbens Reveals Cell-Type-Specific Dysregulation in Adolescent Macaques with Depressive-Like Behaviors; Authors - Teng Teng