Home
Products
Primary Antibodies
FKBP8 Polyclonal antibody, PBS Only (11173-1-PBS)

Filter: AllWBIPIF/ICC

WB analysis of HeLa using 11173-1-AP (same clone as 11173-1-PBS)
WB result of FKBP8 antibody (11173-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FKBP8 transfected HeLa cells. This data was developed using the same antibody clone with 11173-1-PBS in a different storage buffer formulation.
WB analysis using 11173-1-AP (same clone as 11173-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11173-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 11173-1-AP (same clone as 11173-1-PBS)
WB result of FKBP8 antibody (11173-1-AP; 1:5000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FKBP8 transfected HeLa cells. This data was developed using the same antibody clone with 11173-1-PBS in a different storage buffer formulation.
WB analysis of mouse liver using 11173-1-AP (same clone as 11173-1-PBS)
mouse liver tissue were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11173-1-PBS in a different storage buffer formulation.
WB analysis of SH-SY5Y using 11173-1-AP (same clone as 11173-1-PBS)
SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11173-1-PBS in a different storage buffer formulation.
WB analysis of mouse brain using 11173-1-AP (same clone as 11173-1-PBS)
mouse brain tissue were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11173-1-PBS in a different storage buffer formulation.
WB analysis of mouse pancreas using 11173-1-AP (same clone as 11173-1-PBS)
mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11173-1-PBS in a different storage buffer formulation.
WB analysis of Jurkat using 11173-1-AP (same clone as 11173-1-PBS)
Jurkat cells were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11173-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 11173-1-AP (same clone as 11173-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11173-1-PBS in a different storage buffer formulation.
WB analysis of mouse brain using 11173-1-AP (same clone as 11173-1-PBS)
mouse brain tissue were subjected to SDS PAGE followed by western blot with 11173-1-AP (FKBP8 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11173-1-PBS in a different storage buffer formulation.
IP experiment of HeLa using 11173-1-AP (same clone as 11173-1-PBS)
IP result of anti-FKBP8 (IP:11173-1-AP, 4ug; Detection:11173-1-AP 1:500) with HeLa cells lysate 3200ug. This data was developed using the same antibody clone with 11173-1-PBS in a different storage buffer formulation.
IF Staining of A431 using 11173-1-AP (same clone as 11173-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed A431 cells using FKBP8 antibody (11173-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 11173-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

FKBP8 Polyclonal antibody, PBS Only

Name: FKBP8 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 11173-1-PBS

FKBP8 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 11173-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

FK506 binding protein 8, FK506-binding protein 8, FKBP 38, FKBP 8, FKBP38

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

11173-1-PBS targets FKBP8 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag1649 Product name: Recombinant human FKBP8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-355 aa of BC009966 Sequence: MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN Predict reactive species
Full Name	FK506 binding protein 8, 38kDa
Calculated Molecular Weight	45 kDa
Observed Molecular Weight	53 kDa
GenBank Accession Number	BC009966
Gene Symbol	FKBP8
Gene ID (NCBI)	23770
RRID	AB_10597097
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q14318
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

FK506 binding protein 8 (FKBP8), is a member of the immunophilin protein family, which plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP8 does not seem to have PPIase/rotamase activity, which is different from other members of this family. The active form of FKBP8 may play a role in the regulation of apoptosis. FKBP8 has 3 isoforms produced by alternative splicing.