FKBP8 Monoclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 66690-1-Ig (same clone as 66690-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66690-1-Ig (FKBP8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66690-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66690-1-Ig (same clone as 66690-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66690-1-Ig (FKBP8 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66690-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66690-1-Ig (same clone as 66690-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66690-1-Ig (FKBP8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66690-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 66690-1-Ig (same clone as 66690-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66690-1-Ig (FKBP8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66690-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66690-1-Ig (same clone as 66690-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66690-1-Ig (FKBP8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66690-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66690-1-Ig (same clone as 66690-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66690-1-Ig (FKBP8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66690-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 66690-1-Ig (same clone as 66690-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66690-1-Ig (FKBP8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66690-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hypothalamus using 66690-1-Ig (same clone as 66690-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hypothalamus tissue slide using 66690-1-Ig (FKBP8 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66690-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66690-1-Ig (same clone as 66690-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66690-1-Ig (FKBP8 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66690-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 66690-1-Ig (same clone as 66690-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using FKBP8 antibody (66690-1-Ig, Clone: 1C1G12 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66690-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FKBP8 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66690-1-PBS

Clone No.1C1G12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FKBP-38, FKBP38, FKBP 8, FKBP 38, FK506-binding protein 8

---

Product Information

66690-1-PBS targets FKBP8 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1649

  Product name: Recombinant human FKBP8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-355 aa of BC009966

  Sequence: MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN

• Full Name: FK506 binding protein 8, 38kDa
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC009966
• Gene Symbol: FKBP8
• Gene ID (NCBI): 23770
• RRID: AB_2882044
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14318
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FK506 binding protein 8 (FKBP8), is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP8 does not seem to have PPIase/rotamase activity, which is different from other members of this family. The active form of FKBP8 may play a role in the regulation of apoptosis. FKBP8 has 3 isoforms produced by alternative splicing.