FKBP8 Monoclonal antibody

• 

  WB analysis of Jurkat using 66690-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66690-1-Ig (FKBP8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 66690-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66690-1-Ig (FKBP8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 66690-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66690-1-Ig (FKBP8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 66690-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66690-1-Ig (FKBP8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 66690-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66690-1-Ig (FKBP8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66690-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66690-1-Ig (FKBP8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 66690-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66690-1-Ig (FKBP8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human hypothalamus using 66690-1-Ig

  Immunohistochemical analysis of paraffin-embedded human hypothalamus tissue slide using 66690-1-Ig (FKBP8 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 66690-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66690-1-Ig (FKBP8 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 66690-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using FKBP8 antibody (66690-1-Ig, Clone: 1C1G12 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

FKBP8 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66690-1-Ig

Clone No.1C1G12

Publications(3)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

FKBP-38, FKBP38, FKBP 8, FKBP 38, FK506-binding protein 8

---

Tested Applications

• Positive WB detected in: Jurkat cells, HEK-293 cells, HeLa cells, HepG2 cells, NIH/3T3 cells, RAW 264.7 cells
• Positive IHC detected in: human hypothalamus tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 2 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

66690-1-Ig targets FKBP8 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1649

  Product name: Recombinant human FKBP8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-355 aa of BC009966

  Sequence: MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN

• Full Name: FK506 binding protein 8, 38kDa
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC009966
• Gene Symbol: FKBP8
• Gene ID (NCBI): 23770
• RRID: AB_2882044
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14318
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FK506 binding protein 8 (FKBP8), is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP8 does not seem to have PPIase/rotamase activity, which is different from other members of this family. The active form of FKBP8 may play a role in the regulation of apoptosis. FKBP8 has 3 isoforms produced by alternative splicing.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	bioRxiv; Tau phosphorylation suppresses oxidative stress-induced mitophagy via FKBP8 receptor modulation; Authors - Michael O Isei ; KD Validated
mouse	WB	PLoS One; Tau phosphorylation suppresses oxidative stress-induced mitophagy via FKBP8 receptor modulation; Authors - Michael O Isei ; KD Validated
human	CoIP	J Biol Chem; Lysine demethylase KDM1A promotes cell growth via FKBP8-BCL2 axis in hepatocellular carcinoma; Authors - Suli Lv