FLT3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FLT3 Polyclonal antibody, PBS Only (30297-1-PBS)

• 

  WB analysis using 30297-1-AP (same clone as 30297-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 30297-1-AP (FLT3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30297-1-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 30297-1-AP (same clone as 30297-1-PBS)

  WB result of FLT3 antibody (30297-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-FLT3 transfected THP-1 cells. This data was developed using the same antibody clone with 30297-1-PBS in a different storage buffer formulation.

• 

  IP experiment of THP-1 using 30297-1-AP (same clone as 30297-1-PBS)

  IP result of anti-FLT3 (IP:30297-1-AP, 4ug; Detection:30297-1-AP 1:500) with THP-1 cells lysate 2720 ug. This data was developed using the same antibody clone with 30297-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 30297-1-AP (same clone as 30297-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using FLT3 antibody (30297-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 30297-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FLT3 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 30297-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

CD135, Fetal liver kinase-2, FL cytokine receptor, FLK2, FLK-2

---

Product Information

30297-1-PBS targets FLT3 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32898

  Product name: Recombinant human FLT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 683-810 aa of BC126350

  Sequence: LSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHR

• Full Name: fms-related tyrosine kinase 3
• Calculated Molecular Weight: 112 kDa
• Observed Molecular Weight: 130 kDa, 150 kDa
• GenBank Accession Number: BC126350
• Gene Symbol: FLT3
• Gene ID (NCBI): 2322
• RRID: AB_3086289
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36888
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FLT3 (also known as CD135 or FLK2) is a tyrosine-protein kinase that acts as a cell-surface receptor for the cytokine FLT3LG and regulates differentiation, proliferation, and survival of hematopoietic progenitor cells and of dendritic cells. FLT3 was originally identified by its expression in hematopoietic stem/progenitor cells (PMID: 7507245). It is important for the normal development of hematopoietic stem/progenitor cells. Mutations that result in the constitutive activation of this receptor result in acute myeloid leukemia and acute lymphoblastic leukemia.