Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

FNDC3B Polyclonal antibody, PBS Only

FNDC3B Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 22605-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

FAD104, fibronectin type III domain containing 3B, Fibronectin type III domain-containing protein 3B, HCV NS5A-binding protein 37, UNQ2421/PRO4979/PRO34274

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

22605-1-PBS targets FNDC3B in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18357

Product name: Recombinant human FNDC3B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 3-370 aa of BC039297

Sequence: VTMMMTDQIPLELPPLLNGEVAMMPHLVNGDAAQQVILVQVNPGETFTIRAEDGTLQCIQGPAEVPMMSPNGSIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSSYITREDQYSKPPHKKLKDRQIDRQNRLNSPPSSIYKSSCTTVYNGYGKGHSGGSGGGGSGSGPGIKKTERRARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYNSVKGSCSEPV

Predict reactive species
Full Name fibronectin type III domain containing 3B
Calculated Molecular Weight 1204 aa, 133 kDa
Observed Molecular Weight 150 kDa, 70 kDa
GenBank Accession NumberBC039297
Gene Symbol FNDC3B
Gene ID (NCBI) 64778
RRIDAB_2879133
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ53EP0
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Fibronectin type III domain-containing protein 3B(FNDC3B), also named FAD104, belongs to the FNDC3 family. NDC3B is a positive regulator of adipocyte differentiation and is expressed at an early stage of adipocyte differentiation. FNDC3B is an endoplasmic reticulum transmembrane protein with a single transmembrane domain at the C terminus preceded by nine repeated fibronectin type III domains(PMID: 32966780). Due to the ability of the fibronectin type III domain to bind to a variety of proteins, FNDC3B plays a crucial role in cell adhesion, proliferation, and growth signaling. FNDC3B is abnormally expressed in a variety of human cancers, including hepatocellular carcinoma, acute myeloid leukemia, colorectal carcinoma, and cervical carcinoma(PMID: 36275754).

Loading...
||
New chat

Able

正在加载,请稍候...