CoraLite® Plus 488-conjugated FOXF1 Recombinant monoclonal antibody

FOXF1 Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-84020-3
Clone No.241076C8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

241076C8

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84020-3 targets FOXF1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34266

Product name: Recombinant human FOXF1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 154-379 aa of NP_001442

Sequence: MYSMMNGLGFNHLPDTYGFQGSAGGLSCPPNSLALEGGLGMMNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGGCGGAAAGEYPHHDSSVPASPLLPTGAGGVMEPHAVYSGSAAAWPPSASAALNSGASYIKQQPLSPCNPAANPLSGSLSTHSLEQPYLHQNSHNAPAELQGIPRYHSQSPSMCDRKEFVFSFNAMASSSMHSAGGGSYYHQQVTYQDIKPCVM

Predict reactive species
Full Name forkhead box F1
Calculated Molecular Weight40 kDa
Observed Molecular Weight40 kDa
GenBank Accession NumberNP_001442
Gene Symbol FOXF1
Gene ID (NCBI) 2294
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ12946
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FOXF1 (Forkhead box protein F1), also known as FKHL5, It is expected to be located in the nucleus, which is expressed predominantly in lung and placenta. FOXF1, a member of the Forkhead box family of transcription factors, as one of the most highly and consistently upregulated genes in FP-RMS. While it is known that FOXF1 is required for mesodermal differentiation toward endothelial and smooth muscle cell lineages, FOXF1 is not expressed in differentiated skeletal muscle cells, and its role in fusion-positive FP-RMS remains unknown (PMID: 33627785). The molecular weight of FOXF1 is 40 kDa.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 FOXF1 antibody CL488-84020-3Download protocol
IF protocol for CL Plus 488 FOXF1 antibody CL488-84020-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...