FOXO1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82997-1-RR (same clone as 82997-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82997-1-RR (FOXO1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82997-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 82997-1-RR (same clone as 82997-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 82997-1-RR (FOXO1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82997-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 82997-1-RR (same clone as 82997-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using FOXO1 antibody (82997-1-RR, Clone: 230183D1 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 82997-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 82997-1-RR (same clone as 82997-1-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug FOXO1 Recombinant antibody (82997-1-RR, Clone:230183D1) and PE-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 82997-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82997-1-RR

  Biolayer interferometry (BLl) kinetic assays of 82997-1-RR against Human FOXO1 were performed. The affinity constant is 0.188 nM.

FOXO1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 82997-1-PBS

Clone No.230183D1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

230183D1, FKH 1, FKH1, FKHR, forkhead box O1

---

Product Information

82997-1-PBS targets FOXO1 in WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag13296

  Product name: Recombinant human FOXO1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 301-655 aa of BC021981

  Sequence: SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

• Full Name: forkhead box O1
• Calculated Molecular Weight: 655 aa, 70 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC021981
• Gene Symbol: FOXO1
• Gene ID (NCBI): 2308
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q12778
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FOXO1, also named as FOXO1A, FKHR and FKH1, is a member of the FOXO subfamily of Forkhead transcription factors. FOXO1 is a transcription factor which acts as a regulator of cell responses to oxidative stress. FOXO1 interacts with LRPPRC and SIRT1. In the presence of KIRT1, FOXO1 mediates down-regulation of cyclin D1 and up-regulation of CDKN1B levels which are required for cell transition from proliferative growth to quiescence. FOXO1 contains three predicted protein kinase B phosphorylation sites (Thr-24, Ser-256, and Ser-319) that are conserved in other FOXO proteins. The t(2;13) and the variant t(1;13) translocations generate PAX3/FKHR and PAX7/FKHR fusion proteins respectively. The resulting protein is a transcriptional activator. Defects in FOXO1 are a cause of rhabdomyosarcoma type 2 (RMS2).