FOXO1 Recombinant monoclonal antibody, PBS Only

FOXO1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 82997-1-PBS
Clone No.230183D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

230183D1, FKH 1, FKH1, FKHR, forkhead box O1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82997-1-PBS targets FOXO1 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13296

Product name: Recombinant human FOXO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 301-655 aa of BC021981

Sequence: SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

Predict reactive species
Full Name forkhead box O1
Calculated Molecular Weight 655 aa, 70 kDa
Observed Molecular Weight 70-80 kDa
GenBank Accession NumberBC021981
Gene Symbol FOXO1
Gene ID (NCBI) 2308
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ12778
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FOXO1, also named as FOXO1A, FKHR and FKH1, is a member of the FOXO subfamily of Forkhead transcription factors. FOXO1 is a transcription factor which acts as a regulator of cell responses to oxidative stress. FOXO1 interacts with LRPPRC and SIRT1. In the presence of KIRT1, FOXO1 mediates down-regulation of cyclin D1 and up-regulation of CDKN1B levels which are required for cell transition from proliferative growth to quiescence. FOXO1 contains three predicted protein kinase B phosphorylation sites (Thr-24, Ser-256, and Ser-319) that are conserved in other FOXO proteins. The t(2;13) and the variant t(1;13) translocations generate PAX3/FKHR and PAX7/FKHR fusion proteins respectively. The resulting protein is a transcriptional activator. Defects in FOXO1 are a cause of rhabdomyosarcoma type 2 (RMS2).

Loading...
||
New chat Able
正在加载,请稍候...