FOXO1 Recombinant monoclonal antibody

FOXO1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA
Cat No. 82997-1-RR
Clone No.230183D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

230183D1, FKH 1, FKH1, FKHR, forkhead box O1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HepG2 cells, HEK-293 cells, MCF-7 cells
Positive IHC detected inhuman pancreas cancer tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

82997-1-RR targets FOXO1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13296

Product name: Recombinant human FOXO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 301-655 aa of BC021981

Sequence: SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

Predict reactive species
Full Name forkhead box O1
Calculated Molecular Weight 655 aa, 70 kDa
Observed Molecular Weight 70-80 kDa
GenBank Accession NumberBC021981
Gene Symbol FOXO1
Gene ID (NCBI) 2308
RRIDAB_3670744
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ12778
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FOXO1, also named as FOXO1A, FKHR and FKH1, is a member of the FOXO subfamily of Forkhead transcription factors. FOXO1 is a transcription factor which acts as a regulator of cell responses to oxidative stress. FOXO1 interacts with LRPPRC and SIRT1. In the presence of KIRT1, FOXO1 mediates down-regulation of cyclin D1 and up-regulation of CDKN1B levels which are required for cell transition from proliferative growth to quiescence. FOXO1 contains three predicted protein kinase B phosphorylation sites (Thr-24, Ser-256, and Ser-319) that are conserved in other FOXO proteins. The t(2;13) and the variant t(1;13) translocations generate PAX3/FKHR and PAX7/FKHR fusion proteins respectively. The resulting protein is a transcriptional activator. Defects in FOXO1 are a cause of rhabdomyosarcoma type 2 (RMS2).

Protocols

Product Specific Protocols
FC protocol for FOXO1 antibody 82997-1-RRDownload protocol
IF protocol for FOXO1 antibody 82997-1-RRDownload protocol
IHC protocol for FOXO1 antibody 82997-1-RRDownload protocol
WB protocol for FOXO1 antibody 82997-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Ethnopharmacol

Chinese herbal medicine alleviates autophagy and apoptosis in ovarian granulosa cells induced by testosterone through PI3K/AKT1/FOXO1 pathway

Authors - Weihuan Hu
Loading...
||
New chat Able
正在加载,请稍候...