FOXR2 Polyclonal antibody

• 

  WB analysis of SH-SY5Y using 14111-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 14111-1-AP (FOXR2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of SH-SY5Y using 14111-1-AP

  Immunofluorescent analysis of (-20℃ Acetone) fixed SH-SY5Y cells using 14111-1-AP (FOXR2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

FOXR2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 14111-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

FOXR 2, FOXN6

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 5 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

14111-1-AP targets FOXR2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5257

  Product name: Recombinant human FOXR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-311 aa of BC012934

  Sequence: MDLKLKDCEFWYSLHGQVPGLLDWDMRNELFLPCTTDQCSLAEQILAKYRVGVMKPPEMPQKRRPSPDGDGPPCEPNLWMWVDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSNCSEDKVVESLPSSSSEQSPLQKQGIHSPSDFELTEEEAEEPDDNSLQSPEMKCYQSQKLWQINNQEKSWQRPPLNCSHLIALALRNNPHCGLSVQEIYNFTRQHFPFFWTAPDGWKSTIHYNLCFLDSFEKVPDSLKDEDNARPRSCLWKLTKEGHRRFWEETRVLAFAQRERIQECMSQPELLTSLFDL

• Full Name: forkhead box R2
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC012934
• Gene Symbol: FOXR2
• Gene ID (NCBI): 139628
• RRID: AB_2878015
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6PJQ5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Tumour Biol; FOXR2 contributes to cell proliferation and malignancy in human hepatocellular carcinoma.; Authors - Xiao Wang
human	WB,IHC	Neoplasma; The tumor suppressor NOR1 suppresses cell growth, invasiveness, and tumorigenicity in glioma.; Authors - J Cai
human	WB	Med Sci Monit; PMID: 31761897; Authors - Yangle Li ; KD Validated
human	WB	iScience; EPC1/2 regulate hematopoietic stem and progenitor cell proliferation by modulating H3 acetylation and DLST; Authors - WenYe Liu
human,mouse	WB,IF	Cancer Res; FOXR2 Is an Epigenetically Regulated Pan-Cancer Oncogene That Activates ETS Transcriptional Circuits; Authors - Jessica W Tsai