FPGS Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FPGS Polyclonal antibody, PBS Only (27616-1-PBS)

• 

  WB analysis using 27616-1-AP (same clone as 27616-1-PBS)

  HeLa mitochondrial extracts were subjected to SDS PAGE followed by western blot with 27616-1-AP (FPGS antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27616-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 27616-1-AP (same clone as 27616-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27616-1-AP (FPGS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27616-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 27616-1-AP (same clone as 27616-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27616-1-AP (FPGS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27616-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 27616-1-AP (same clone as 27616-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27616-1-AP (FPGS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27616-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 27616-1-AP (same clone as 27616-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27616-1-AP (FPGS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27616-1-PBS in a different storage buffer formulation.

FPGS Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27616-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Tetrahydrofolate synthase

---

Product Information

27616-1-PBS targets FPGS in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24775

  Product name: Recombinant human FPGS protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 397-587 aa of BC064393

  Sequence: QGRERPSGGPEVRVLLFNATGDRDPAALLKLLQPCQFDYAVFCPNLTEVSSTGNADQQNFTVTLDQVLLRCLEHQQHWNHLDEEQASPDLWSVPSPEPGGSASLLLAPHPPHTCSASSLVFSCISHALQWISQGRDPIFQPPSPPKGLLTHPVAHSGASILREAAAIHVLVTGSLHLVGGVLKLLEPALSQ

• Full Name: folylpolyglutamate synthase
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC064393
• Gene Symbol: FPGS
• Gene ID (NCBI): 2356
• RRID: AB_3669615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q05932
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FPGS is located in the cytosol and mitochondria of mammalian tissues, with current evidence supporting a single gene encoding for both the cytosolic and mitochondrial isoenzymes. FPGS catalyzes a rate-limiting polyglutamylation step in the folic acid metabolic pathway and increases the intracellular retention of folates (PMID: 8907263, PMID: 31611592). FPGS has 4 isoforms with the molecular mass of 59-65 kDa.