FPR1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FPR1 Polyclonal antibody, PBS Only (26164-1-PBS)

• 

  WB analysis using 26164-1-AP (same clone as 26164-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26164-1-AP (FPR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26164-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26164-1-AP (same clone as 26164-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26164-1-AP (FPR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26164-1-PBS in a different storage buffer formulation.

FPR1 Polyclonal Antibody for WB, ELISA

Cat No. 26164-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

fMet Leu Phe receptor, FMLP, fMLP receptor, formyl peptide receptor 1, FPR

---

Product Information

26164-1-PBS targets FPR1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23105

  Product name: Recombinant human FPR1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 140-203 aa of BC005315

  Sequence: SLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGI

• Full Name: formyl peptide receptor 1
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC005315
• Gene Symbol: FPR1
• Gene ID (NCBI): 2357
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21462
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FPR1 is a Gi-coupled innate immune GPCR that detects formylated peptides from bacteria and damaged mitochondria, initiating leukocyte chemotaxis and inflammatory activation. Predominantly expressed in neutrophils and monocytes, FPR1 functions as a frontline danger sensor in host defense. Dysregulated FPR1 signaling contributes to infectious susceptibility, acute inflammatory injury, and tumor-associated immune modulation, underscoring its importance in innate immunity and inflammatory disease.