FREM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FREM1 Polyclonal antibody, PBS Only (13086-1-PBS)

• 

  WB analysis of human plasma using 13086-1-AP (same clone as 13086-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 13086-1-AP (FREM1 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 13086-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 13086-1-AP (same clone as 13086-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13086-1-AP (FREM1 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 13086-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocellular cancer using 13086-1-AP (same clone as 13086-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocellular cancer slide using 13086-1-AP (FREM1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13086-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 13086-1-AP (same clone as 13086-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13086-1-AP (FREM1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13086-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 13086-1-AP (same clone as 13086-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13086-1-AP (FREM1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13086-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 13086-1-AP (same clone as 13086-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using FREM1 antibody (13086-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 13086-1-PBS in a different storage buffer formulation.

FREM1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13086-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

C9orf143, C9orf145, C9orf154, FRAS1-related extracellular matrix protein 1

---

Product Information

13086-1-PBS targets FREM1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3617

  Product name: Recombinant human FREM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 412-710 aa of BC031064

  Sequence: SSSTTSGSFHLERRPLPSSMQLAVIRGDTLRGFDSTDLSQRKLRTRGNGKTVRPSSVYRNGTDIIYNYHGIVSLKLEDDSFPTHKRKAKVSIISQPQKTIKVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLYQCNGIAWKAWSPQTKDVEDKSCPAGWHQHSGYCHILITEQKGTWNAAAQACREQYLGNLVTVFSRQHMRWLWDIGGRKSFWIGLNDQVHAGHWEWIGGEPVAFTNGRRGPSPRSKLGKSCVLVQRQGKWQTKDCRRAKPHNYGCSRKL

• Full Name: FRAS1 related extracellular matrix 1
• Calculated Molecular Weight: 2179aa, 244 kDa, 149.3 kDa
• Observed Molecular Weight: 40-43 kDa, 70-80 kDa
• GenBank Accession Number: BC031064
• Gene Symbol: FREM1
• Gene ID (NCBI): 158326
• RRID: AB_2877915
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5H8C1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FREM1, C9orf143, C9orf145, C9orf154 and QBRICK, is an extracellular matrix protein that plays a role in epidermal differentiation and is required for epidermal adhesion during embryonic development. This antibody recognizes isoform 1 (244 kDa), isform 2 (80 kDa) and isoform 3 (43 kDa).