FRY Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FRY Polyclonal antibody, PBS Only (32075-1-PBS)

• 

  WB analysis using 32075-1-AP (same clone as 32075-1-PBS)

  Various lysates were subjected to Tris-Acetate gel system followed by western blot with 32075-1-AP (FRY antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32075-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 32075-1-AP (same clone as 32075-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 32075-1-AP (FRY antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32075-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 32075-1-AP (same clone as 32075-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 32075-1-AP (FRY antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32075-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human urothelial carcinoma using 32075-1-AP (same clone as 32075-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 32075-1-AP (FRY antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32075-1-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 32075-1-AP (same clone as 32075-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using FRY antibody (32075-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 32075-1-PBS in a different storage buffer formulation.

FRY Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 32075-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

C13orf14, FRY Microtubule Binding Protein, Protein furry homolog

---

Product Information

32075-1-PBS targets FRY in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34959

  Product name: Recombinant human FRY protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2534-2680 aa of NM_023037

  Sequence: LEHSDLIMTLSPSEETNPMELLTTACDSTPAEPHSFNTRMSSFDASLPDMNNLQISEGSKAEAVREEEDTTVHEDDLSSSINELPAAFECSDSFSLDMTEGEEKGNRALDQFTLASFGEGDRGVSPPPSPFFSAILAAFQPAACDDA

• Full Name: furry homolog (Drosophila)
• Calculated Molecular Weight: 339 kDa
• Observed Molecular Weight: 340 kDa
• GenBank Accession Number: NM_023037
• Gene Symbol: FRY
• Gene ID (NCBI): 10129
• RRID: AB_3742522
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5TBA9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The FRY gene encodes a protein involved in cell cycle regulation and DNA damage response. It plays a crucial role in the G2/M checkpoint, ensuring cells complete DNA repair before entering mitosis by activating the ATR-CHK1 signaling pathway. FRY is expressed in various tissues, including brain, liver, and testis, with notable expression in Sertoli and spermatogonial cells. Aberrant FRY function is associated with multiple diseases, such as cancer and neurodegenerative disorders. In cancer cells, FRY expression can influence proliferation and survival. Understanding FRY's role in cell cycle control and genome stability is vital for elucidating disease mechanisms and developing targeted therapies.