FTCD Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 83664-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 83664-3-PBS against Human FTCD was performed. The affinity constant is 16.3 nM.

FTCD Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83664-3-PBS

Clone No.240654A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

Formimidoyltetrahydrofolate cyclodeaminase, Formimidoyltransferase-cyclodeaminase, Formiminotransferase-cyclodeaminase, Glutamate formimidoyltransferase, Glutamate formiminotransferase

---

Product Information

83664-3-PBS targets FTCD in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16646

  Product name: Recombinant human FTCD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 192-541 aa of BC136395

  Sequence: TKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE

• Full Name: formiminotransferase cyclodeaminase
• Calculated Molecular Weight: 541 aa, 59 kDa
• GenBank Accession Number: BC136395
• Gene Symbol: FTCD
• Gene ID (NCBI): 10841
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95954
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.