FTSJ2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FTSJ2 Polyclonal antibody, PBS Only (22556-1-PBS)

• 

  WB analysis of human skeletal muscle using 22556-1-AP (same clone as 22556-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 22556-1-AP (FTSJ2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22556-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 22556-1-AP (same clone as 22556-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 22556-1-AP (FTSJ2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22556-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 22556-1-AP (same clone as 22556-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 22556-1-AP (FTSJ2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22556-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse skeletal muscle using 22556-1-AP (same clone as 22556-1-PBS)

  IP result of anti-FTSJ2 (IP:22556-1-AP, 3ug; Detection:22556-1-AP 1:500) with mouse skeletal muscle tissue lysate 4000ug. This data was developed using the same antibody clone with 22556-1-PBS in a different storage buffer formulation.

FTSJ2 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 22556-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

22556-1-PBS targets FTSJ2 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18410

  Product name: Recombinant human FTSJ2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-246 aa of BC114514

  Sequence: MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQILRPSLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ

• Full Name: FtsJ homolog 2 (E. coli)
• Calculated Molecular Weight: 246 aa, 27 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC114514
• Gene Symbol: FTSJ2
• Gene ID (NCBI): 29960
• RRID: AB_2879122
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9UI43
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Putative ribosomal RNA methyltransferase 2 (FTSJ2), also named as FJH1 or Protein FTSJ homolog 2 is a 246 amino acid protein, which belongs to the methyl-transferase superfamily. FTSJ2 localizes in the nucleus and is widely expressed in in muscle, placenta, and heart. FTSJ2 functions as a nucleolar RNA methyl-transferase involved in eukaryotic RNA processing and modification.