CoraLite® Plus 488-conjugated FTSJ3 Recombinant monoclonal antibody

• 

  IF Staining of MCF-7 using CL488-84311-6

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CoraLite® Plus 488 FTSJ3 antibody (CL488-84311-6, Clone: 241507F2 ) at dilution of 1:200.

FTSJ3 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84311-6

Clone No.241507F2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

241507F2, EC:2.1.1.-, EPCS3, FTSJ 3, pre-rRNA 2'-O-ribose RNA methyltransferase FTSJ3

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84311-6 targets FTSJ3 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9835

  Product name: Recombinant human FTSJ3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 491-847 aa of BC036710

  Sequence: KRMRLTEVQDDKEEEEEENPLLVPLEEKAVLQEEQANLWFSKGSFAGIEDDADEALEISQAQLLFENRRKGRQQQQKQQLPQTPPSCLKTEIMSPLYQDEAPKGTEASSGTEAATGLEGEEKDGISDSDSSTSSEEEESWEPLRGKKRSRGPKSDDDGFEIVPIEDPAKHRILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIRQLPVGKKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDISEREKVAQLRSLYKKAGLGKEKRHVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQQRKEQKKKHKRK

• Full Name: FtsJ homolog 3 (E. coli)
• Calculated Molecular Weight: 847 aa, 97 kDa
• Observed Molecular Weight: 120-130 kDa
• GenBank Accession Number: BC036710
• Gene Symbol: FTSJ3
• Gene ID (NCBI): 117246
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IY81
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

FTSJ3 is an RNA 2'-O-methyltransferase recruited by HIV to avoid innate immune sensing.