FUBP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FUBP1 Polyclonal antibody, PBS Only (24864-1-PBS)

• 

  WB analysis of SH-SY5Y using 24864-1-AP (same clone as 24864-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 24864-1-AP (FUBP1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24864-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 24864-1-AP (same clone as 24864-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 24864-1-AP (FUBP1 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24864-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 24864-1-AP (same clone as 24864-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24864-1-AP (FUBP1 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24864-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 24864-1-AP (same clone as 24864-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24864-1-AP (FUBP1 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24864-1-PBS in a different storage buffer formulation.

• 

  IP experiment of SH-SY5Y using 24864-1-AP (same clone as 24864-1-PBS)

  IP result of anti-FUBP1 (IP:24864-1-AP, 4ug; Detection:24864-1-AP 1:3000) with SH-SY5Y cells lysate 1480 ug. This data was developed using the same antibody clone with 24864-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 24864-1-AP (same clone as 24864-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using FUBP1 antibody (24864-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 24864-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FUBP1 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 24864-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

Far upstream element-binding protein 1, FUSE-binding protein 1

---

Product Information

24864-1-PBS targets FUBP1 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13149

  Product name: Recombinant human FUBP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 303-653 aa of BC017247

  Sequence: DAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSVQAGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGPPGPPGPGTPMGPYNPAPYNPGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPAKAGTDPNSAAWAAYYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQCRFDPASIELAL

• Full Name: far upstream element (FUSE) binding protein 1
• Calculated Molecular Weight: 653 aa, 69 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC017247
• Gene Symbol: FUBP1
• Gene ID (NCBI): 8880
• RRID: AB_2879762
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AE4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FUBP1 also termed as FBP and FUSE-binding protein 1 is 644 amino-acid protein, which localizes in the nucleus. FUBP1 binds to a single-stranded far-upstream element (FUSE) upstream of the MYC promoter and regulates the MYC expression, indicating that FBP1 functions as a growth-dependent regulator of c-Myc expression. FUBP1 binds to FUSE, and PUF60, and forms a stable tripartite complex, which represses activated but not basal c-myc transcription after transcription initiation by delaying promoter escape. FUBP1 may be acting both as activator and repressor of transcription.