• Featured Product
  • KD/KO Validated

FUS/TLS Polyclonal antibody

FUS/TLS Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, IP, ELISA
Cat No. 11570-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, ChIP, RIP, ELISA

FUS, 75 kDa DNA pairing protein, 75 kDa DNA-pairing protein, ALS, ALS6

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue
Positive IP detected inK-562 cells
Positive IHC detected inmouse brain tissue, human ovary tumor tissue, rat brain tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse colon tissue, mouse liver tissue
Positive IF-Fro detected inrat brain tissue
Positive IF/ICC detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11570-1-AP targets FUS/TLS in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2150

Product name: Recombinant human FUS/TLS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 53-400 aa of BC026062

Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG

Predict reactive species
Full Name fusion (involved in t(12;16) in malignant liposarcoma)
Calculated Molecular Weight 75 kDa
Observed Molecular Weight 68-75 kDa
GenBank Accession NumberBC026062
Gene Symbol FUS/TLS
Gene ID (NCBI) 2521
RRIDAB_2247082
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35637
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FUS (also named TLS and POMp75) belongs to the RRM TET family. FUS may play a role in the maintenance of genomic integrity; it binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. FUS is also an RNA-binding protein, and its links to neurodegenerative disease proffer the intriguing possibility that altered RNA metabolism or RNA processing may underlie or contribute to neuron degeneration[PMID: 22640227]. FUS may be a cause of angiomatoid fibrous histiocytoma (AFH) and is implicated in certain forms of amyotrophic lateral sclerosis (ALS) and frontotemporal dementias (FTDs) such as frontotemporal lobar dementia with ubiquitin inclusions (FTLD-U)[PMID: 22640227]. This antibody is a rabbit polyclonal antibody raised against an internal region of human FUS. FUS was detected double bands of 68-74 kDa (PMID:31519807).

Protocols

Product Specific Protocols
WB protocol for FUS/TLS antibody 11570-1-APDownload protocol
IHC protocol for FUS/TLS antibody 11570-1-APDownload protocol
IF protocol for FUS/TLS antibody 11570-1-APDownload protocol
IP protocol for FUS/TLS antibody 11570-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Nature

Divergent transcriptional regulation of astrocyte reactivity across disorders.

Authors - Joshua E Burda
humanIHC,IF

Nature

Mutations in UBQLN2 cause dominant X-linked juvenile and adult-onset ALS and ALS/dementia.

Authors - Deng Han-Xiang HX
mouse,humanWB

Nat Med

Antisense oligonucleotide silencing of FUS expression as a therapeutic approach in amyotrophic lateral sclerosis.

Authors - Vladislav A Korobeynikov
humanWB,IF

Cell

Nuclear-Import Receptors Reverse Aberrant Phase Transitions of RNA-Binding Proteins with Prion-like Domains.

Authors - Lin Guo
humanWB

Cell Metab

NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis.

Authors - Mi Kyung Park
mouseWB

Nat Neurosci

FUS-mediated regulation of acetylcholine receptor transcription at neuromuscular junctions is compromised in amyotrophic lateral sclerosis.

Authors - Gina Picchiarelli
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Xiaochen (Verified Customer) (07-08-2024)

Sensitivie for IF and show image with good quelity.

  • Applications: Immunofluorescence
  • Cell Tissue Type: U2OS
FUS/TLS Antibody Immunofluorescence validation ( dilution) in U2OS (Cat no:11570-1-AP)
FH

Xhuljana (Verified Customer) (03-01-2024)

Used in siRNA transfected C2C12 cells

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: C2C12 cells
FUS/TLS Antibody Western Blot validation (1:1000 dilution) in C2C12 cells (Cat no:11570-1-AP)
FH

Zhongwen (Verified Customer) (09-25-2023)

I can find two bands in the target region. I am not sure which one is the target band.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T
FUS/TLS Antibody Western Blot validation (1:1000 dilution) in HEK293T (Cat no:11570-1-AP)
FH

manohar (Verified Customer) (07-10-2023)

Nitrocellulose membrane is used with 5% milk as blocking and antibody diluted in 1% milk and incubated overnight.

  • Applications: Western Blot, Immunofluorescence, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293, Neuronal stem cells, Mouse tissue
FH

Tatyana (Verified Customer) (05-14-2023)

ICC using 5% goat serum/PBST buffer, 2 hours at RT. Good specific nuclear signal.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HeLa
FUS/TLS Antibody Immunofluorescence validation (1:1000 dilution) in HeLa (Cat no:11570-1-AP)
FH

shashirekha (Verified Customer) (12-23-2020)

Used for immunopreciptation at 1:1000 dilution. Works very well

  • Applications: Immunoprecipitation
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Rat cortical neurons
FUS/TLS Antibody Immunoprecipitation validation (1:1000 dilution) in Rat cortical neurons (Cat no:11570-1-AP)
FH

H (Verified Customer) (04-06-2020)

The antibody worked well for HCT116 cell line. Nuclear cytosolic fractionation clearly showed that FUS is dominantly in nucleus, and sub-fraction is present in cytosol.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: HCT116
FUS/TLS Antibody Western Blot validation (1:2000 dilution) in HCT116 (Cat no:11570-1-AP)
FH

Karthik (Verified Customer) (04-24-2019)

Magenta- FUSBlue- MAP2FUS staining consistent obtained with this antibody is consistent with literature

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:250 overnight at 4 degrees
  • Cell Tissue Type: motor neurons
FH

Yen-Chen (Verified Customer) (12-03-2018)

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: human motor neuron
Loading...
||
New chat Able
正在加载,请稍候...