FUT10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• FUT10 Polyclonal antibody, PBS Only (18660-1-PBS)

• 

  WB analysis of HeLa using 18660-1-AP (same clone as 18660-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 18660-1-AP (FUT10 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18660-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 18660-1-AP (same clone as 18660-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 18660-1-AP (FUT10 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18660-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 18660-1-AP (same clone as 18660-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 18660-1-AP (FUT10 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 18660-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 18660-1-AP (same clone as 18660-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 18660-1-AP (FUT10 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 18660-1-PBS in a different storage buffer formulation.

FUT10 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 18660-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

18660-1-PBS targets FUT10 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13415

  Product name: Recombinant human FUT10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 172-521 aa of BC063462

  Sequence: NIDSLPLPRKAHHDWAVFHEESPKNNYKLFHKPVITLFNYTATFSRHSHLPLTTQYLESIEVLKSLRYLVPLQSKNKLRKRLAPLVYVQSDCDPPSDRDSYVRELMTYIEVDSYGECLRNKDLPQQLKNPASMDADGFYRIIAQYKFILAFENAVCDDYITEKFWRPLKLGVVPVYYGSPSITDWLPSNKSAILVSEFSHPRELASYIRRLDSDDRLYEAYVEWKLKGEISNQRLLTAVREPKWGVQDVNQDNYIDAFECMVCTKVWANIRLQEKGLPPKRWEAEDTHLSCPEPTVFAFSPLRTPPLSSLREMWISSFEQSKKEAQALRWLVDRNQNFSSQEFWGLVFKD

• Full Name: fucosyltransferase 10 (alpha (1,3) fucosyltransferase)
• Calculated Molecular Weight: 521 aa, 61 kDa
• Observed Molecular Weight: 41-48 kDa
• GenBank Accession Number: BC063462
• Gene Symbol: FUT10
• Gene ID (NCBI): 84750
• RRID: AB_10641997
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P4F1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.