CoraLite® Plus 488-conjugated FUT4 Polyclonal antibody

FUT4 Polyclonal Antibody for IF/ICC
Cat No. CL488-22141

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Alpha (1,3) fucosyltransferase, CD15, ELFT, FCT3A, FUC TIV, Fucosyltransferase 4, Fucosyltransferase IV, FucT IV, FUT4, FUTIV, SSEA 1, SSEA1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-22141 targets FUT4 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17565

Product name: Recombinant human FUT4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 174-407 aa of BC136374

Sequence: QLPPLPWASPTPSRPVGVLLWWEPFGGRDSAPRPPPDCRLRFNISGCRLLTDRASYGEAQAVLFHHRDLVKGPPDWPPPWGIQAHTAEEVDLRVLDYEEAAAAAEALATSSPRPPGQRWVWMNFESPSHSPGLRSLASNLFNWTLSYRADSDVFVPYGYLYPRSHPGDPPSGLAPPLSRKQGLVAWVVSHWDERQARVRYYHQLSQHVTVDVFGRGGPGQPVPEIGLLHTVARY

Predict reactive species
Full Name fucosyltransferase 4 (alpha (1,3) fucosyltransferase, myeloid-specific)
Calculated Molecular Weight 530 aa, 59 kDa
Observed Molecular Weight 45 kDa, 63 kDa
GenBank Accession NumberBC136374
Gene Symbol FUT4
Gene ID (NCBI) 2526
RRIDAB_3084062
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP22083
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FUT4, also named as ELFT and FCT3A, belongs to the glycosyltransferase 10 family. FUT4 may catalyze alpha-1,3 glycosidic linkages involved in the expression of Lewis X/SSEA-1 and VIM-2 antigens. The expression of CD15 (acts as a terminal glycotope in glycoproteins and glycolipids) is directed by FUT4 in promyelocytes and monocytes. FUT4 is an antigenic epitope defined as a Lewis X carbohydrate structure is expressed on murine embryonal carcinoma cells (EC), murine ES and iPS cells, and murine and human germ cells. It is widely used as a positive surface marker for mouse undifferentiated ES and iPS cells and a negative surface marker for human undifferentiated ES and iPS cells. Expression is down-regulated following differentiation of murine EC and ES cells, while the differentiation of human EC and ES cells is accompanied by an increase in FUT4 expression. FUT4 is associated with cell adhesion, migration and differentiation. 22141-1-AP detects the band around 45 kDa and glycosylated isoform 63 kDa protein in SDS-PAGE. (PMID: 22287018, 17335083, 11278338)

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 FUT4 antibody CL488-22141Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...