FUT8 Monoclonal antibody, PBS Only

• 

  WB analysis of MDA-MB-231 using 66118-1-Ig (same clone as 66118-1-PBS)

  MDA-MB-231 cells were subjected to SDS PAGE followed by western blot with 66118-1-Ig (FUT8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66118-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 66118-1-Ig (same clone as 66118-1-PBS)

  WB result of FUT8 antibody (66118-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FUT8 transfected MCF-7 cells. This data was developed using the same antibody clone with 66118-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MDA-MB-453s using 66118-1-Ig (same clone as 66118-1-PBS)

  MDA-MB-453s cells were subjected to SDS PAGE followed by western blot with 66118-1-Ig (FUT8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66118-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 66118-1-Ig (same clone as 66118-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66118-1-Ig (FUT8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66118-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Caco-2 using 66118-1-Ig (same clone as 66118-1-PBS)

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 66118-1-Ig (FUT8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66118-1-Ig (same clone as 66118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66118-1-Ig (FUT8 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66118-1-Ig (same clone as 66118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66118-1-Ig (FUT8 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 66118-1-Ig (same clone as 66118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 66118-1-Ig (FUT8 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 66118-1-Ig (same clone as 66118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 66118-1-Ig (FUT8 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66118-1-Ig (same clone as 66118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 66118-1-Ig (FUT8 Antibody) at dilution of 1:50 under 40x lens. This data was developed using the same antibody clone with 66118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66118-1-Ig (same clone as 66118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66118-1-Ig (FUT8 Antibody) at dilution of 1:50 under 10x lens. This data was developed using the same antibody clone with 66118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66118-1-Ig (same clone as 66118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66118-1-Ig (FUT8 Antibody) at dilution of 1:50 under 40x lens. This data was developed using the same antibody clone with 66118-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66118-1-Ig (same clone as 66118-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 66118-1-Ig (FUT8 Antibody) at dilution of 1:50 under 10x lens. This data was developed using the same antibody clone with 66118-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

FUT8 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66118-1-PBS

Clone No.2F7H2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

2F7H2, Alpha-(1,6)-fucosyltransferase, alpha1 6FucT, Alpha1-6FucT, EC:2.4.1.68

---

Product Information

66118-1-PBS targets FUT8 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18769

  Product name: Recombinant human FUT8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 276-575 aa of BC025385

  Sequence: HWSGEVKDKNVQVVEFPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTKYPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANFHSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK

• Full Name: fucosyltransferase 8 (alpha (1,6) fucosyltransferase)
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC025385
• Gene Symbol: FUT8
• Gene ID (NCBI): 2530
• RRID: AB_2881517
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BYC5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fucosyltransferase 8 (FUT8) is GDP-fucose-glycoprotein fucosyltransferase and is localized in Golgi apparatus. FUT8 is involved in protein glycosylation by catalyzing the addition of fucose in alpha 1-6 linkage to the first GlcNAc residue, next to the peptide chains in N-glycans. FUT8 may be involved in human aging by regulating protein N-glycosylation and in the molecular pathogenesis of human pulmonary emphysema (PE).