FceR1a Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• FceR1a Recombinant monoclonal antibody, PBS Only (84662-4-PBS)

• 

  WB analysis of MC/9 using 84662-4-RR (same clone as 84662-4-PBS)

  MC/9 cells were subjected to SDS PAGE followed by western blot with 84662-4-RR (Fc epsilon RI alpha antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84662-4-PBS in a different storage buffer formulation.

• 

  WB analysis of KU812 using 84662-4-RR (same clone as 84662-4-PBS)

  KU812 cells were subjected to SDS PAGE followed by western blot with 84662-4-RR (FceR1a antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84662-4-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 84662-4-RR (same clone as 84662-4-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 84662-4-RR (FceR1a antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84662-4-PBS in a different storage buffer formulation.

• 

  Affinity of 84662-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84662-4-RR against Human FceR1a were performed. The affinity constant is below 1 pM.

FceR1a Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84662-4-PBS

Clone No.241848D6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Fc epsilon RI alpha, FCE1A, Fc-epsilon RI-alpha, FcERI, FceRIa

---

Product Information

84662-4-PBS targets FceR1a in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2022

  Product name: Recombinant Human Fc Epsilon RI Alpha protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 26-205 aa of NM_001387280.1

  Sequence: VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

• Full Name: Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: NM_001387280.1
• Gene Symbol: FceR1a
• Gene ID (NCBI): 2205
• RRID: AB_3743641
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P12319
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fc epsilon Receptor I alpha (FceR1a) is a single-pass type I membrane protein that contains 2 immunoglobulin-like domains. FceR1a forms a tetrameric complex, FceRI, with one beta and two gamma subunits (PMID: 19406478). FceRI is the high-affinity receptor for the Fc region of immunoglobulin E (IgE) (PMID: 1532373). It is expressed on mast cells and basophils and plays a central role in the allergic response (PMID: 2148316). The calculated molecular weight of FceR1a is 30 kDa, the 45- to 55-kDa bands detected by this antibody are probably caused by heterogeneous glycosylation.