Anti-Mouse FceR1a Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Mouse FceR1a Rabbit Recombinant Antibody (98289-1-RR)

• 

  FC experiment of MC/9 using 98289-1-RR

  1x10^6 MC/9 cells were surface stained with 0.25 ug Anti-Mouse Fc-epsilon RI-alpha (FcERI) Rabbit RecAb (98289-1-RR, Clone: 242008G6) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

• 

  Affinity and Kinetic Characterization of 98289-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98289-1-RR against Mouse FceR1a were performed. The affinity constant is below 1 pM.

FceR1a Uni-rAb^® Recombinant Antibody for FC

Cat No. 98289-1-RR

Clone No.242008G6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

242008G6, Fce1a, FceR1, FcERI, Fcr 5

---

Tested Applications

• Positive FC detected in: MC/9 cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98289-1-RR targets FceR1a in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1740

  Product name: Recombinant Mouse FceR1a protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-204 aa of NM_010184.2

  Sequence: ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQ

• Full Name: Fc receptor, IgE, high affinity I, alpha polypeptide
• Calculated Molecular Weight: 29 kDa
• GenBank Accession Number: NM_010184.2
• Gene Symbol: FceR1a
• Gene ID (NCBI): 14125
• RRID: AB_3745955
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P20489
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Fc epsilon Receptor I alpha (FceR1a) is a single-pass type I membrane protein that contains 2 immunoglobulin-like domains. FceR1a forms a tetrameric complex, FceRI, with one beta and two gamma subunits (PMID: 19406478). FceRI is the high-affinity receptor for the Fc region of immunoglobulin E (IgE) (PMID: 1532373). It is expressed on mast cells and basophils and plays a central role in the allergic response (PMID: 2148316).