Fibromodulin Monoclonal antibody, PBS Only

• 

  WB analysis of human kidney using 60108-1-Ig (same clone as 60108-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 60108-1-Ig (Fibromodulin antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60108-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 60108-1-Ig (same clone as 60108-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 60108-1-Ig (Fibromodulin antibody) at dilution of 1:250 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60108-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human stomach using 60108-1-Ig (same clone as 60108-1-PBS)

  human stomach tissue were subjected to SDS PAGE followed by western blot with 60108-1-Ig (Fibromodulin antibody) at dilution of 1:250 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60108-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 60108-1-Ig (same clone as 60108-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 60108-1-Ig (Fibromodulin antibody) at dilution of 1:300 (under 10x lens). This data was developed using the same antibody clone with 60108-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 60108-1-Ig (same clone as 60108-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 60108-1-Ig (Fibromodulin antibody) at dilution of 1:300 (under 40x lens). This data was developed using the same antibody clone with 60108-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Fibromodulin Monoclonal Antibody for IHC, Indirect ELISA

Cat No. 60108-1-PBS

Clone No.3E9D10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

fibromodulin, FM, FMOD, KSPG fibromodulin, SLRR2E

---

Product Information

60108-1-PBS targets Fibromodulin in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4030

  Product name: Recombinant human FMOD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-376 aa of BC035281

  Sequence: MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI

• Full Name: fibromodulin
• Calculated Molecular Weight: 376 aa, 43 kDa
• GenBank Accession Number: BC035281
• Gene Symbol: Fibromodulin
• Gene ID (NCBI): 2331
• RRID: AB_2105538
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q06828
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Fibromodulin (FMOD), an extracellular matrix protein, belongs to the small leucine-rich proteoglycan family. Fibromodulin is a collagen-binding protein present in many types of connective tissues, e.g. cartilage, tendon, skin, sclera and cornea (PMID: 2531085). It is involved in fibrillogenesis, cell adhesion, and cytokine activity modulation (PMID: 15741214). Fibromodulin may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. The calculated molecular mass of fibromodulin is 43 kDa, extracellular fibromodulin appears as one single band of 59 kDa due to glycosylation (PMID: 2531085; 22138190).