Ficolin 3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Ficolin 3 Polyclonal antibody, PBS Only (11867-1-PBS)

• 

  WB analysis of human plasma using 11867-1-AP (same clone as 11867-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 11867-1-AP (Ficolin-3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11867-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11867-1-AP (same clone as 11867-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using Ficolin 3 antibody (11867-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 11867-1-PBS in a different storage buffer formulation.

Ficolin 3 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 11867-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Hakata antigen, HAKA1, FCNH, FCN3, Collagen/fibrinogen domain-containing protein 3

---

Product Information

11867-1-PBS targets Ficolin 3 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2449

  Product name: Recombinant human FCN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 20-288 aa of BC020731

  Sequence: CLKTQEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR

• Full Name: ficolin (collagen/fibrinogen domain containing) 3 (Hakata antigen)
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC020731
• Gene Symbol: Ficolin-3
• Gene ID (NCBI): 8547
• RRID: AB_2104432
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75636
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ficolins are a group of oligomeric lectins with subunits consisting of both collagen-like and fibrinogen-like domains (PMID: 20375620). They are innate pattern recognition receptors and play integral roles within the innate immune response. In humans, there are three ficolins termed M-, L-, and H-ficolin (also referred to as ficolin-1, -2, and -3) whereas rodents only possess ficolin-A and -B, which are the orthologues of human L- and M-ficolin, respectively (PMID: 30868077). Ficolin-3 (Hakata antigen or H-ficolin) was initially identified based on its reactivity with sera from patients with systemic lupus erythematosus (PMID: 1859827). It has been shown to have a calcium-independent lectin activity. Ficolin-3 is associated with MASPs and sMAP, and which activates the lectin pathway (PMID: 11907111). Ficolin-3 shows affinity for GalNAc, GlcNAc, D-fucose and galactose (PMID: 30868077).