Filaggrin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Filaggrin Polyclonal antibody, PBS Only (26931-1-PBS)

• 

  IHC staining of human paracancerous of skin squamous cell cancer using 26931-1-AP (same clone as 26931-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human paracancerous of skin squamous cell cancer tissue slide using 26931-1-AP (Filaggrin antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26931-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human paracancerous of skin squamous cell cancer using 26931-1-AP (same clone as 26931-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human paracancerous of skin squamous cell cancer tissue slide using 26931-1-AP (Filaggrin antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26931-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin squamous cell cancer using 26931-1-AP (same clone as 26931-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin squamous cell cancer tissue slide using 26931-1-AP (Filaggrin antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26931-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin squamous cell cancer using 26931-1-AP (same clone as 26931-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin squamous cell cancer tissue slide using 26931-1-AP (Filaggrin antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26931-1-PBS in a different storage buffer formulation.

Filaggrin Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 26931-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

FLG

---

Product Information

26931-1-PBS targets Filaggrin in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25389

  Product name: Recombinant human Filaggrin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-102 aa of NM_002016

  Sequence: MRKENLPISGHKHRKHSHHDKHEDNKQEENKENRKRPSSLERRNNRKGNKGRSKSPRETGGKRHESSSEKKERKGYSPTHREEEYGKNHHNSSKKEKNKTEN

• Full Name: filaggrin
• Calculated Molecular Weight: 435 kDa
• GenBank Accession Number: NM_002016
• Gene Symbol: FLG
• Gene ID (NCBI): 2312
• RRID: AB_3742205
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20930
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Profilaggrin is a major protein component of the keratohyalin granules of mammalian epidermis. It is initially expressed as a large polyprotein precursor, which is subsequently proteolytically processed into individual functional filaggrin molecules. The free filaggrin binds to keratin intermediate filaments, causing their aggregation into macrofibrils in which the intermediate filaments are aligned in tightly packed parallel arrays. Mutations in Filaggrin are associated with Ichthyosis vulgaris and Dermatitis atopic 2.(PMID: 19386895, 16550169)