Flightless I Monoclonal antibody, PBS Only

Flightless I Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 67039-1-PBS
Clone No.2F9C8

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, Indirect ELISA

FLI, Fli1, Flightless I, FLII, FLIL, Protein flightless 1 homolog

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67039-1-PBS targets Flightless I in WB, IHC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26865

Product name: Recombinant human FLII protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 440-900 aa of BC025300

Sequence: DQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGGTASGFYTVEDTHYVTRMYRVYGKKNIKLEPVPLKGTSLDPRFVFLLDRGLDIYVWRGAQATLSSTTKARLFAEKINKNERKGKAEITLLVQGQELPEFWEALGGEPSEIKKHVPEDFWPPQPKLYKVGLGLGYLELPQINYKLSVEHKQRPKVELMPRMRLLQSLLDTRCVYILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEW

Predict reactive species
Full Name flightless I homolog (Drosophila)
Calculated Molecular Weight 1269 aa, 145 kDa
Observed Molecular Weight 145-150 kDa
GenBank Accession NumberBC025300
Gene Symbol Flightless I
Gene ID (NCBI) 2314
RRIDAB_2882353
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13045
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Flightless I (FliI) is the most evolutionarily conserved member of the gelsolin superfamily of proteins which are key regulators of actin filament assembly and turnover. FliI comprises an N-terminal leucine-rich repeat (LRR) domain which is not present in other gelsolin family members, and the LRR domain may enable interactions between FliI and other molecules involved in signal transduction, thereby spatially integrating signaling and actin remodeling functions. This protein was originally found in Drosophila and participates in the embryonic development, while mammalian FliI protein was involved in the regulation of wound repair,skin barrier development. Studies recently demonstrated that FliI protein associated with colorectal cancer, hepatocellular and prostate cancer (PMID:30091651; 28498392).

Loading...
||
New chat Able
正在加载,请稍候...